CAZyme Information: MGYG000002354_00918

Basic Information

• Species: Moellerella wisconsensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Moellerella; Moellerella wisconsensis
• CAZyme ID: MGYG000002354_00918
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	MGYG000002354_9|CGC1	62808.31	9.4732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002354	3303166	Isolate	not provided	not provided

• Gene Location: Start: 75761; End: 77395 Strand: +

Full Sequence      

MQQRTFEWSKWLLLLIFVILTYFLPLNGRLLWQPDELRYAEISRELISSHNWVIPQLLDI
RYFEKPVMGYWINAIFQVLFGESNLSVRLGVVFSTLISGLFIYLSAMLAWNNRRLAYNAV
FIYLSTFIVFTIGTYNVLDPILTAFVTMMMFCFQWGLAARSIKHKLAAYLLLGVACGGGF
LTKGFLAFLLPALIMGIAAIYYRQFKQVILFSLVSLFSACLVCLPWVWLIAKQEPDYWNY
FFWVEHIQRFMSDNAQNKSPFWFYIPILLVGLLPWLGYFFNALYRAFKNKGINYYYLLWF
ILPFIFFSITKGKLLTYILPCIAPVSILIASYLESYLSQHKTTLIKLNGIINLLIGLAGA
TAIILSNYFTQWRVYGAEESDKILLAVGSFLFWAIVALFTFKKRFWYLAGACTLVLSLTV
GYAIPQKIASNNTPQQVIEKYQYQLADKQYLMTNNVGLGTSLAWVLKRSDITMLHQKGEL
AYGLAYPDVNDRFYSLSQLNELLAKNDYRHVAIVIDASQKTILAALPHQPRVIREGDLML
IFYD

Enzyme Prediction     

No EC number prediction in MGYG000002354_00918.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	6	507	5.2e-119	0.9425925925925925

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	10	544	7	551	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	4.73e-67	10	502	8	516	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	2.08e-19	12	241	6	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	1.57e-14	65	228	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam03901	Glyco_transf_22	3.31e-04	12	371	1	367	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWS49534.1	1.44e-270	1	544	3	546
QIF56355.1	2.04e-270	1	544	3	546
QIF60405.1	2.04e-270	1	544	3	546
QZY64885.1	2.04e-270	1	544	3	546
BBV11032.1	5.63e-270	1	544	1	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	8.14e-30	3	328	22	359	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B4EUL1	8.93e-193	7	544	7	548	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
Q7N3Q9	1.62e-163	13	544	13	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=arnT PE=2 SV=1
B4ETL9	4.22e-161	12	544	12	550	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT2 PE=3 SV=1
B1JJ32	2.94e-156	13	544	11	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=arnT PE=3 SV=1
Q66A06	5.88e-156	13	544	11	551	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=arnT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999342	0.000250	0.000165	0.000001	0.000001	0.000288

TMHMM  Annotations     

start	end
11	33
86	108
115	137
141	159
166	181
185	202
209	231
262	284
291	310
314	336
349	368
383	400
405	424