CAZyme Information: MGYG000002354_02063

Basic Information

• Species: Moellerella wisconsensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Moellerella; Moellerella wisconsensis
• CAZyme ID: MGYG000002354_02063
• CAZy Family: GH15
• CAZyme Description: Glucoamylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769	MGYG000002354_18|CGC3	85108.27	6.207

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002354	3303166	Isolate	not provided	not provided

• Gene Location: Start: 495890; End: 498199 Strand: -

Full Sequence      

MSEQQAPGGPGSTATWTSSAKDMVGTAIGQGRVWFTLGYGILNEVYWPSCSTPQIRDLGF
IIAGDDFWSEVKRVHQYELTTPSSSLPLPKIVHQHERYRLELEIITDPARDVLLIKYQLE
GEGLKLYPLLAPHLAGDGDNNYGSISAQGLVAHKKDHHLILAAKNGFTRGSVGYVGCSDG
WQDFHQNGCMRWEYQQAGPGNIAMMGELNCNSGVLALAFSDSAQGAATLAHSSLAAGYPE
ARRQYAYLWAAWHETVNFPGLDKLPKRLSDAVRTSIAVIKTHEGRNFPGALVASLSTPWG
DTHKDPGGYHLVWPRDSVEVGFAMLACGLIAEVRALMAYLIAIQQPDGHWMQNNFTDGQP
YWQGIQLDEVALPVLFAAKLHEQGLLGEMQGAAIKMARKALSFIAQYGPASPQDRWEENS
GINPFTLSVSIAALVAGAQAGFLEDGDKQYALDLADDWNERLESWVYVANTQLDRELAIS
GHYIRLNPNCHSARFGEVMLRNRNNETINTRALIGMEYLYLVRLGLRKASDKRIQDTTKL
VDKLLCVQLPAGPYYYRYNQDGYGEHDDGRAFDGSGVGRLWPLLSGERGYYAAACKEDIQ
PYLNAILASASTGGMLPEQIWDKPSIPERGLITGRPSGSAMPLIWAHAELIKLIYVQKTG
VAIEQLTSVSGRYRDQPPVARARHWRDNLSCGAVPVSHELWIESQEPFVLHYGYDNWQDI
KEQTSQPLGLGLYGVMVNVSGLGGKTLQFTRRFDGRGWEGRDWQIDIIA

Enzyme Prediction     

No EC number prediction in MGYG000002354_02063.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	277	654	1.7e-77	0.9722991689750693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01535	glucan_glucosid	0.0	32	673	2	648	glucan 1,4-alpha-glucosidase. Glucan 1,4-alpha-glucosidase catalyzes the hydrolysis of terminal 1,4-linked alpha-D-glucose residues from non-reducing ends of polysaccharides, releasing a beta-D-glucose monomer. Some forms of this enzyme can hydrolyze terminal 1,6- and 1,3-alpha-D-glucosidic bonds in polysaccharides as well. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd07430	GH15_N	3.54e-105	7	252	1	260	Glycoside hydrolase family 15, N-terminal domain. Members of this family are N-terminal domains uniquely found in bacterial and archaeal glucoamylases and glucodextranases. Glucoamylase (glucan 1,4-alpha-glucosidase; 4-alpha-D-glucan glucohydrolase; amyloglucosidase; exo-1,4-alpha-glucosidase; gamma-amylase; lysosomal alpha-glucosidase; EC 3.2.1.3) hydrolyzes beta-1,4-glucosidic linkages of starch, glycogen and malto-oligosaccharides, releasing beta-D-glucose from the non-reducing end. Glucodextranase (glucan 1,6-alpha-glucosidase; exo-1,6-alpha-glucosidase; EC 3.2.1.70) uses an inverting reaction mechanism to hydrolyze alpha-1,6-glucosidic linkages of dextran and related oligosaccharides, releasing beta-D-glucose from the non-reducing end. These N-terminal domains adopt a structure consisting of antiparallel beta-strands, divided into two beta-sheets, with one sheet wrapped by an extended polypeptide, which appears to stabilize the domain. The function of these domains in the enzymes is as yet unknown. However, it is suggested that domain N of bacterial GA is involved in folding and/or the thermostability of the A domain that forms an (alpha/alpha)6-barrel structure.
pfam09137	Glucodextran_N	3.36e-97	6	253	1	262	Glucodextranase, domain N. Members of this family, which are uniquely found in bacterial and archaeal glucoamylases and glucodextranases, adopt a structure consisting of 17 antiparallel beta-strands. These beta-strands are divided into two beta-sheets, and one of the beta-sheets is wrapped by an extended polypeptide, which appears to stabilize the domain. Members of this family are mainly concerned with catalytic activity, hydrolysing alpha-1,6-glucosidic linkages of dextran to release beta-D-glucose from the non-reducing end via an inverting reaction mechanism.
COG3387	SGA1	1.29e-65	33	655	9	602	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
pfam00723	Glyco_hydro_15	3.49e-27	265	655	1	417	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQO62638.1	0.0	1	769	1	769
AVE41515.1	0.0	1	767	1	767
BBV06664.1	0.0	1	767	1	767
QET98155.1	0.0	1	767	1	767
QIB28400.1	0.0	1	767	1	767

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UG9_A	3.10e-113	5	680	4	690	CrystalStructure of Glucodextranase from Arthrobacter globiformis I42 [Arthrobacter globiformis],1ULV_A Crystal Structure of Glucodextranase Complexed with Acarbose [Arthrobacter globiformis]
1LF6_A	4.05e-103	6	653	22	662	CRYSTALSTRUCTURE OF BACTERIAL GLUCOAMYLASE [Thermoanaerobacterium thermosaccharolyticum],1LF6_B CRYSTAL STRUCTURE OF BACTERIAL GLUCOAMYLASE [Thermoanaerobacterium thermosaccharolyticum],1LF9_A Crystal Structure Of Bacterial Glucoamylase Complexed With Acarbose [Thermoanaerobacterium thermosaccharolyticum],1LF9_B Crystal Structure Of Bacterial Glucoamylase Complexed With Acarbose [Thermoanaerobacterium thermosaccharolyticum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29761	2.74e-100	6	653	39	679	Glucoamylase OS=Clostridium sp. (strain G0005) OX=72582 GN=cga PE=1 SV=1
Q59005	1.04e-11	289	655	284	607	Uncharacterized glycosyl hydrolase MJ1610 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1610 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000015	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002354_02063.