CAZyme Information: MGYG000002355_01655

Basic Information

• Species: Clostridium_F botulinum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_F; Clostridium_F botulinum
• CAZyme ID: MGYG000002355_01655
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
309	MGYG000002355_9|CGC14	35857.28	9.818

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002355	3808262	Isolate	Italy	Europe

• Gene Location: Start: 1370967; End: 1371896 Strand: +

Full Sequence      

MKKATGLILKLMILVLLAFTIFIMFNSLILNKKNERFLPENAMNIYIKAADEVSENKLQV
NWKYIAALDGVKNKGDFSKANIEDSKVLGKKFLEISKSTKFKNTNYRLLTLDEVISKMSF
TEEENKNVHKYLDKLNNIYPITPDEYKRQFIDELIPISKELYDEYGILPSVTIGQAILES
DWGRSELSKKGNNLFGIKATPSWQGKVLNMETSENYNDKIKDNFRYYSSKEDSIKDYANF
LVKNKRYRENKVFRATEYKTQAKAIEKAGYSTKKDKDGNLLYSSLLGKIIREYNLQLIDS
KTQEEISKK

Enzyme Prediction     

No EC number prediction in MGYG000002355_01655.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	157	295	3.5e-36	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.20e-51	147	299	43	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	1.69e-27	149	291	154	295	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	1.94e-25	156	237	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
NF038016	sporang_Gsm	4.27e-24	149	295	162	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
smart00047	LYZ2	3.25e-22	150	297	11	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ13633.1	1.07e-213	1	309	1	309
QGT42391.1	4.37e-213	1	309	1	309
AWB30441.1	4.37e-213	1	309	1	309
ABS35706.1	4.37e-213	1	309	1	309
CAL83322.1	4.37e-213	1	309	1	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	2.87e-14	148	272	4	133	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.92e-14	148	272	4	133	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3FI7_A	6.31e-14	146	299	29	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
3VWO_A	7.65e-14	150	272	4	131	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	9.22e-14	150	272	5	132	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.52e-23	150	299	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	1.18e-13	150	272	163	290	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q2G222	4.03e-13	83	308	238	481	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P15931	7.91e-13	140	272	138	282	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	1.92e-12	148	272	150	279	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991466	0.006843	0.000262	0.000023	0.000018	0.001406

TMHMM  Annotations     

start	end
7	29