CAZyme Information: MGYG000002356_00286

Basic Information

• Species: Bacillus_A wiedmannii
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A wiedmannii
• CAZyme ID: MGYG000002356_00286
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
645		75970.69	5.3397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002356	5414628	Isolate	Netherlands	Europe

• Gene Location: Start: 63132; End: 65069 Strand: -

Full Sequence      

MDVINCEEVKRDEFHTEKYYDSYNIFGAHIVTEDGMRGVRFTVWAPHAKAMSVVGDFNEW
DYEQHKMLQVTEEGIWSLFVPHIEENEIYKYAIETMDGDVILKADPYAVYAEVRPNTASV
VFDIEGYEWNDKNWIRKRKKKSIYKEAMTVYELHFGSWKKKEDGALYSYREMAEELIPYV
VEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMYFVDECHKYGIGVILDW
VPGHFCKDAHGLYLFDGTPTYEYKDIDVQENLVWGTVNFDLGKREVRNFLISNALFWMKY
FHIDGFRVDAVANMLYWNKEGQEQSNEYAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLV
TAPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKYIHEKMTFSLIYAYSENFILPLSHD
EVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDW
NLHDFEMHRYMHDYFKELIALYKRSKPLWQLDHSPEGFQWIDANNHEQSIFSFIRQGDKQ
EDALVVVCNFTKATYENYKVGLPDFEYYNEILNSDAEQYGGSGQVNKKRLKTIQEPYHNQ
AAHVEITIPPFGVSILRPVKTRKGSKKQDGSKAKVRSNVTSRGKR

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	178	468	8.3e-144	0.9966777408637874
CBM48	26	110	2.1e-18	0.881578947368421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	14	624	15	633	1,4-alpha-glucan branching protein GlgB.
PRK14706	PRK14706	0.0	24	619	25	622	glycogen branching enzyme; Provisional
PRK14705	PRK14705	0.0	23	618	620	1222	glycogen branching enzyme; Provisional
COG0296	GlgB	0.0	14	618	14	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK05402	PRK05402	0.0	14	621	108	726	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWH68717.1	0.0	1	645	1	645
AZJ22932.1	0.0	1	645	1	645
QIW19073.1	0.0	1	645	1	645
QWH74576.1	0.0	1	645	1	645
QWI19152.1	0.0	1	645	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GR5_A	1.20e-221	14	625	137	782	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQU_A	1.70e-221	14	625	137	782	Crystalstructure of branching enzyme from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQV_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltohexaose [Crocosphaera subtropica ATCC 51142],5GQY_A Crystal structure of branching enzyme from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GQW_A	2.41e-221	14	625	137	782	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR0_A	4.83e-221	14	625	137	782	Crystalstructure of branching enzyme D501A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GR2_A	4.83e-221	14	625	137	782	Crystalstructure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GR4_A Crystal structure of branching enzyme L541A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P30537	0.0	14	629	14	628	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus caldolyticus OX=1394 GN=glgB PE=1 SV=1
Q632H1	0.0	9	645	1	637	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus cereus (strain ZK / E33L) OX=288681 GN=glgB PE=3 SV=1
P30538	0.0	14	627	14	625	1,4-alpha-glucan branching enzyme GlgB OS=Geobacillus stearothermophilus OX=1422 GN=glgB PE=1 SV=1
Q6HC15	0.0	1	645	1	645	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) OX=281309 GN=glgB PE=3 SV=1
C3PCL8	0.0	1	645	1	645	1,4-alpha-glucan branching enzyme GlgB OS=Bacillus anthracis (strain A0248) OX=592021 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002356_00286.