CAZyme Information: MGYG000002356_02343

Basic Information

• Species: Bacillus_A wiedmannii
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A wiedmannii
• CAZyme ID: MGYG000002356_02343
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497		57503.24	10.1694

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002356	5414628	Isolate	Netherlands	Europe

• Gene Location: Start: 340952; End: 342445 Strand: +

Full Sequence      

MRQLEEGKDRFNATMYVGSNALFRRTALEEIGGFATGVITEDMATGMLLQANKWETVFVN
ETLAVGLSPETFSDLLKQRDRWCRGNIQVVKKWNPFTLKGLSFMQRLLYADGIHYWFFGV
YKMIFLLAPLLFLVFNIYSLEINFMQLFMFWAPAFLTSQLIFKAVSNKKRTTTWSHVYEV
AMAPYMGFAILSETFLRKKFQFHVTRKGVQNNTRHFLWIASVPHLVLLILTIIALIRAIL
MLLSPEQYHIERESLYINIFWVLYNGIAIITSLFIAFERPRFRNSERFVVNLPGTLQTED
MTISCHVLDISETGARFEVDSSIPFETLSSLSSYTLSFGQVEKIHSTKKWIRRQANSVQI
GVSFHDVSHEQYCKLILHLFSKPVNDRVEKVYDKAFLTLAIASFIKNTKKSPRQFRRQHI
REQLMSPGTLHMNGMPIEATIIDYSTGGCQIQTNTPLAIDQIIQITMNERNIQKKKAKVC
WIQKKGRKIYAGLKFTA

Enzyme Prediction     

No EC number prediction in MGYG000002356_02343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	14	131	4.9e-18	0.6142131979695431

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11498	bcsA	5.21e-45	5	322	407	723	cellulose synthase catalytic subunit; Provisional
cd06421	CESA_CelA_like	1.23e-38	2	89	146	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	2.31e-21	1	202	200	397	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	4.74e-18	12	92	154	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
pfam13632	Glyco_trans_2_3	7.02e-16	13	135	69	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEA15290.1	0.0	1	497	245	741
ARP57052.1	0.0	1	497	245	741
AGG00341.1	0.0	1	497	245	741
AFV17416.1	0.0	1	497	245	741
QFX99305.1	0.0	1	497	245	741

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	6.85e-41	4	320	419	734	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	4.32e-38	3	364	292	661	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	5.64e-38	3	364	304	673	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	5.65e-38	3	364	305	674	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L7	3.65e-40	4	320	419	734	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	3.65e-40	4	320	419	734	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q93IN2	2.22e-39	4	320	419	734	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	5.45e-39	4	320	419	734	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
Q59167	5.08e-37	4	327	293	619	Cellulose synthase 2 OS=Komagataeibacter hansenii OX=436 GN=acsAII PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
113	135
140	162
177	196
217	239
254	276