CAZyme Information: MGYG000002356_03274

Basic Information

• Species: Bacillus_A wiedmannii
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A wiedmannii
• CAZyme ID: MGYG000002356_03274
• CAZy Family: GH113
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		40910.56	9.4531

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002356	5414628	Isolate	Netherlands	Europe

• Gene Location: Start: 112645; End: 113712 Strand: +

Full Sequence      

MKKNKSLVSFLGVFIMLFSFCFQGNVQADVNTVQSGKIKSGNVTVWEVGNVAKVLADVER
LNLNTVNVPIQVDIPNVTSTNMVINQAQKQQAILLIQELLKRNIQVIVEPFPYIQQGNVG
ETEWNPSNINDFFWNWKTVILQDIFNSITSKYNVYGLKIASNFVNMEYAEGYWSDTIDFV
RQQYKGNVLYQMNWWLTASFDPSYEAKFKEKISRPYLKKVDIVSIDSWFEVSGKRNPTYE
EVKKSLFATTVYNRGQNVVQQLEQLHKATGKSVYFGGFNVPARELGLQNPWNPDVSNVFS
KDVQLNGWRAYRDVLEPKPYFKGFSIWFIGSHNSTHAYQIHSKEAEAVINGWYRK

Enzyme Prediction     

No EC number prediction in MGYG000002356_03274.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH113	45	349	3e-38	0.9509803921568627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd19608	GH113_mannanase-like	7.25e-50	36	353	1	310	Glycoside hydrolase family 113 beta-1,4-mannanase and similar proteins. Mannan endo-1,4-beta mannosidase (E.C 3.2.1.78) randomly cleaves (1->4)-beta-D-mannosidic linkages in mannans, galactomannans and glucomannans and is also called beta-1,4-mannanase, endo-1,4-beta-mannanase, endo-beta-1,4-mannase, beta-mannanase B, beta-1, 4-mannan 4-mannanohydrolase, endo-beta-mannanase, beta-D-mannanase, 1,4-beta-D-mannan mannanohydrolase, and 4-beta-D-mannan mannanohydrolase. (1->4)-beta-linked mannans are polysaccharides with a linear polymer backbone of (1->4)-beta-linked mannose units (in plants and fungi) or alternating mannose and glucose/galactose units (glucomannan in plants and fungi, and galactomannan and galactoglucomannan in plants), such as in the hemicellulose fraction of hard- and softwoods. Complete degradation of mannan requires a series of enzymes, including beta-1,4-mannanase. According to the CAZy database beta-1,4-mannanases are grouped into various glycoside hydrolase (GH) families; GH family 113 beta-1,4-mannanases include mostly bacterial and archaeal sequences.
cd19606	GH113-like	2.50e-08	95	353	68	303	Glycoside hydrolase family 113 beta-mannosidase and similar proteins. Family 113 glycoside hydrolases cleave (1->4)-beta-glycosidic linkages, such as endo-1,4-beta-mannanase. This family also includes TIM-barrel domains found in gene transfer agent proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWH72905.1	6.41e-261	1	355	1	355
QIW19799.1	2.61e-260	1	355	1	355
ALQ68834.1	7.48e-260	1	355	1	355
ACK91298.1	1.06e-259	1	355	1	355
QKH01693.1	1.51e-259	1	355	1	355

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000475	0.690956	0.307773	0.000294	0.000263	0.000207

TMHMM  Annotations     

start	end
7	26