CAZyme Information: MGYG000002357_01406

Basic Information

• Species: Bacillus licheniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus licheniformis
• CAZyme ID: MGYG000002357_01406
• CAZy Family: PL26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
863	MGYG000002357_1|CGC21	97717.03	6.5724

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002357	4208157	Isolate	South Korea	Asia

• Gene Location: Start: 1386985; End: 1389576 Strand: +

Full Sequence      

MKAQAELKWLNRAPASFGGVTWGVPWAKGVLQKGETAVIASENAPYLQTWPLAYWPDGSI
KWTGHAAVFPEESGRRFTLQKGKPGAPKTIVRVSEQKDEITVNTGAIVCKLGKSGPALIR
SISISGEMMAKEGRLIALKEKRSGSDTQSMYYIERFESLVKRAAIEQNGPVKTVIKIEGV
HRGGGIDVWLPFTVRLSFYAGVPSIRIVHTIFIDCNAETEWIKGLGLEMSAVLSGAPRNR
HIRYAADGGIYGEASQLLVTRRFNETNGFYERQIAGQPVPEESEVVRDAEKNAVWNDFKL
IQDSPVHWRLKKRTGKDCAWVDAIHGGRAKGLMYAGGENGGIALGLRNFFEKYPSSLEAQ
GLAGGETKLTAWFWPPEAEAMDFRHYSKGTHVESAYEGFAEMRSTAVGIANTSEVNLACF
SNPPSNEELNRAADEWQNPPLLICEPDYYYDTRALGVWSLKDKRRPLSAVLEDQLDEALK
FYMNEVEQRGWYGYWHYGDVMHTYDAVRHVWRYDLGGYAWQNTELVPNLWLWQSFFRSGR
EDIFRMAEAMTRHTSEIDCYHFGDYKGLGSRHNVLHWGCGCKEARISMAGLHKPYYFLTA
DERTGEVLTEVKDADRALEMLDPMRAYYPEKEFPAHARVGPDWAAFCSNWLTEWERTGDE
AYLDKINRGIGRLKALPLRLLSGPTFGYDPKASDLLHMGDGNHGGYHMVIAFGAPQTWME
LAELLEDNEWKEMLGEFGEFYLLADEEKRKRSGGKLHDDLFHWPMFSAAMAAYAARLHQD
RKLAEKAWRLLLDEKQSHTPLPIAPKQVHAWNTITEIPWVTTNCVSQWCLNTIAVLELLK
DMPPDQDMQEKIIKAMKDHPARV

Enzyme Prediction     

No EC number prediction in MGYG000002357_01406.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL26	6	841	0	0.9953596287703016

CDD Domains     

MGYG000002357_01406 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOP14523.1	0.0	1	863	1	863
AKQ72580.1	0.0	1	863	1	863
ARW42191.1	0.0	1	863	1	863
ARC73054.1	0.0	1	863	1	863
ARC71839.1	0.0	1	863	1	863

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XQG_A	1.50e-155	3	845	6	903	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQJ_A Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum]
5XQ3_A	1.72e-154	3	850	6	908	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQ3_B	2.29e-154	3	845	6	903	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQO_A	8.94e-154	3	845	6	903	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum],5XQO_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31530	0.0	6	844	3	847	Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) OX=224308 GN=yetA PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999765	0.000259	0.000010	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002357_01406.