CAZyme Information: MGYG000002358_00244

Basic Information

• Species: Pelistega indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Pelistega; Pelistega indica
• CAZyme ID: MGYG000002358_00244
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		55346.89	4.79

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002358	2504912	Isolate	India	Asia

• Gene Location: Start: 32133; End: 33629 Strand: +

Full Sequence      

MATVTKYGIVTERLDEIIQKFSDGFRAIYGQAINIDPDSPDGQMIGLISQIKVDFEELLE
NVYKQLDPYRATGVWLEQRAAYSGIVRREAKNSYLYSVILTGDPYTDIPAGLVLVDENKN
RWTLVKATQLNSLGSARGDFRSEELGAFFVKEGDSLEIETVIVGLNKAVAFQNAVLGQEE
ETDVELRQRLFLSHAQNAVNSCEAIRAKLHGLRDVEQVLVLENTSNDTDSQGVEGHSINA
IIIGGDDNAIAEVIYENKGAGAGLQGAVEVNLLTEKGNRLIKFDRATVMDIYIKVVIVRE
TDFTQVDTDQLKAELANLKFDIGQDVALSRLYSPINKIDGFWVRELKVGKTAESLGTSNL
FIGIREVARVLEGKRNYAYLDVVGVPTICYGHTQGVNLGDYMNDEECLTLLRNDLNVYYK
AVVDSVTVHMSEVQTAALVSFVYNVGISAFKKSTLLKKLNAGDRIGACDELRRWVNAGGK
PWKGLINRREVERWMCQL

Enzyme Prediction     

No EC number prediction in MGYG000002358_00244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	369	492	2.4e-43	0.927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16900	endolysin_R21-like	1.83e-64	372	496	16	141	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd00737	lyz_endolysin_autolysin	5.71e-50	372	497	9	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	2.35e-37	356	496	4	147	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16901	lyz_P1	3.33e-36	372	496	14	139	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3299	JayE	1.96e-32	1	370	1	348	Uncharacterized phage protein gp47/JayE [Mobilome: prophages, transposons].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIU88991.1	1.32e-44	351	496	15	154
ACT13678.1	1.32e-44	351	496	15	154
AYH25826.1	2.59e-44	351	496	15	154
AIK16071.1	5.48e-42	351	496	15	154
AVN36611.1	4.28e-39	371	496	28	154

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HDF_A	2.53e-33	371	496	9	135	ChainA, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]
3HDE_A	5.25e-33	371	496	34	160	ChainA, Lysozyme [Enterobacteria phage P21],3HDE_B Chain B, Lysozyme [Enterobacteria phage P21],3HDE_C Chain C, Lysozyme [Enterobacteria phage P21],3HDE_D Chain D, Lysozyme [Enterobacteria phage P21]
4ZPU_A	9.67e-33	371	496	34	160	Thestructure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_B The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_C The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_D The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12]
7KH1_A5	2.55e-27	3	332	4	353	ChainA5, baseplate wedge protein, gp16 [Vibrio phage XM1],7KH1_B5 Chain B5, baseplate wedge protein, gp16 [Vibrio phage XM1],7KH1_C5 Chain C5, baseplate wedge protein, gp16 [Vibrio phage XM1],7KH1_D5 Chain D5, baseplate wedge protein, gp16 [Vibrio phage XM1],7KH1_E5 Chain E5, baseplate wedge protein, gp16 [Vibrio phage XM1],7KH1_F5 Chain F5, baseplate wedge protein, gp16 [Vibrio phage XM1],7KH1_G5 Chain G5, baseplate wedge protein, gp16 [Vibrio phage XM1],7KH1_H5 Chain H5, baseplate wedge protein, gp16 [Vibrio phage XM1],7KH1_I5 Chain I5, baseplate wedge protein, gp16 [Vibrio phage XM1],7KH1_J5 Chain J5, baseplate wedge protein, gp16 [Vibrio phage XM1],7KH1_K5 Chain K5, baseplate wedge protein, gp16 [Vibrio phage XM1],7KH1_L5 Chain L5, baseplate wedge protein, gp16 [Vibrio phage XM1]
6ET6_A	1.86e-23	372	493	64	190	ChainA, Lysozyme [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O80292	4.29e-33	371	496	36	162	SAR-endolysin OS=Bacteriophage PS119 OX=83128 GN=19 PE=3 SV=1
P78285	3.98e-32	371	496	34	160	Lysozyme RrrD OS=Escherichia coli (strain K12) OX=83333 GN=rrrD PE=1 SV=1
P10439	2.03e-31	371	496	34	160	SAR-endolysin OS=Enterobacteria phage PA-2 OX=10738 GN=15 PE=3 SV=1
P27359	5.38e-31	371	496	34	160	SAR-endolysin OS=Enterobacteria phage P21 OX=10711 GN=R PE=1 SV=1
O80288	5.69e-31	371	496	36	162	SAR-endolysin OS=Bacteriophage PS34 OX=83127 GN=19 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002358_00244.