CAZyme Information: MGYG000002358_00491

Basic Information

• Species: Pelistega indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Pelistega; Pelistega indica
• CAZyme ID: MGYG000002358_00491
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
488		56013.33	9.6768

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002358	2504912	Isolate	India	Asia

• Gene Location: Start: 10305; End: 11771 Strand: -

Full Sequence      

MNNFKFKQLDLMTIVVMLIGWIPMVLLPFQDTTEPRYAEISRLMASTNDWITPWFEPGVP
FWGKPPLSFWAQALSIKMFGTAEWAVRLPSWLVTCLGLVVLRLALHRVYNEKVSQWAVFI
LSSFALVYLNSGGVLTDPFLTFGTTLCFGSFIVCMSSDVPSKKWGYLFFIGLSIGLLSKG
PLVIVLVGIPIAIYLGLNWSTFTVFKQSFPWKKGFVLMLVLVLPWYIMAEIKTPGFLNYF
IVGEHILRYIDPGWTGDLYGTAHKEFYGKIWLHWLVSSLPWWPVLVVLLVKFKKNHVLEQ
KLATIKKKPLFSFVLAWSLWCGVFFTFSGNILWTYLLPSMVGFALIVAWFVDAQSEGNNP
QMVISLTWLQRVGFLVPVFVVLFSCVAIVYPSMLRTEKGIVQYTEENSPQLPFMYFRKVP
FSATYYSKRTVKSMDDEQMSDYFKNPTLSNQAAYIAVNKGSIDEFKQFSVGNLQEVYRSK
HFILFKVN

Enzyme Prediction     

No EC number prediction in MGYG000002358_00491.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	13	391	1.7e-82	0.6444444444444445

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.99e-42	5	413	2	391	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.23e-20	34	358	33	341	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	9.30e-14	30	240	28	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	4.58e-12	64	225	2	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEC21237.1	2.07e-132	16	487	15	485
AFP30897.1	9.44e-122	5	442	4	435
AKO52566.1	5.33e-121	5	430	4	423
AVL70267.1	5.85e-120	5	488	3	479
QCS62036.1	1.65e-119	18	488	17	499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	9.26e-19	34	375	59	388	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2K5L1	1.50e-20	34	362	34	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=arnT PE=3 SV=1
A9R091	1.50e-20	34	362	34	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=arnT PE=3 SV=1
B1JJ32	1.50e-20	34	362	34	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=arnT PE=3 SV=1
Q1CIH9	1.50e-20	34	362	34	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=arnT PE=3 SV=1
Q1C744	1.50e-20	34	362	34	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999743	0.000028	0.000010	0.000000	0.000000	0.000262

TMHMM  Annotations     

start	end
12	29
84	106
113	135
180	202
214	231
270	289
310	327
331	351
372	394