CAZyme Information: MGYG000002358_01196

Basic Information

• Species: Pelistega indica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Pelistega; Pelistega indica
• CAZyme ID: MGYG000002358_01196
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		27944.74	10.182

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002358	2504912	Isolate	India	Asia

• Gene Location: Start: 12159; End: 12893 Strand: +

Full Sequence      

MTDTLAIRIIHSPIKTCLKYTLLGLLVILLAYQLFLLANVILYRFINPSSTAFMRIKALN
IADDVSPKILYNWSDYEQIDKDIKKAIIASEDSRFTQHFGVEWQAIIDAYYFNLKHENAN
KAKIRGGSTISQQLAKNLFLSQKRSYLRKAQELVITYMIEIIMPKQRIYELYLNTAQLGE
RTFGVTAASRVYFKQDVSKISSAQAATLAALLPNPILYSQHLKSSYMRNRINTIQARMPL
VSIP

Enzyme Prediction     

No EC number prediction in MGYG000002358_01196.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	72	238	1.7e-53	0.9152542372881356

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.11e-76	31	244	18	229	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.34e-70	31	244	13	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	7.58e-51	34	238	39	240	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.13e-47	73	238	15	176	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.48e-33	76	201	72	193	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHG65014.1	2.25e-68	22	244	21	245
SQG70210.1	8.51e-68	21	244	20	244
QQE56035.1	8.51e-68	21	244	20	244
CAP40898.1	8.51e-68	24	244	23	244
QEQ21460.1	8.51e-68	21	244	20	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	4.73e-27	77	238	26	183	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	1.84e-26	77	238	26	183	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	1.33e-22	76	238	44	202	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	5.22e-21	86	237	55	202	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
7U4H_A	1.33e-20	86	219	55	182	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WF82	1.55e-63	28	244	25	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) OX=257310 GN=mtgA PE=3 SV=1
Q7W039	1.55e-63	28	244	25	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) OX=257313 GN=mtgA PE=3 SV=2
Q7W3V2	1.55e-63	28	244	25	242	Biosynthetic peptidoglycan transglycosylase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) OX=257311 GN=mtgA PE=3 SV=1
Q2KUU2	6.14e-60	22	244	17	240	Biosynthetic peptidoglycan transglycosylase OS=Bordetella avium (strain 197N) OX=360910 GN=mtgA PE=3 SV=1
B2JH09	9.79e-55	30	244	34	245	Biosynthetic peptidoglycan transglycosylase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43