CAZyme Information: MGYG000002359_00390

Basic Information

• Species: Mycobacterium tuberculosis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium tuberculosis
• CAZyme ID: MGYG000002359_00390
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MGYG000002359_1|CGC4	41504.04	10.0425

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002359	4387829	Isolate	Sweden	Europe

• Gene Location: Start: 444812; End: 445942 Strand: -

Full Sequence      

MNLANRAASAETAVTQRHLRRLWALPGTQLAVVAWPSTRRDRLFGSWHYWWQAHLLDCLV
DAQLRDPQPQRRARINRQVRSHRVRNNFSWLNSYYDDMAWLALALERADRVAGVRRRRAL
PKLTNQFVEAWVPEDGGGIPWRKQDQFFNAPANGPAGLFLARYPDQYGKRLKRAEQMADW
IDRTLIDPETHLVFDGIKAGSLVRAQYTYCQGVVLGLETELAVRTGPAARARHCARVHRL
VAAVNEHMAPLGVLRGAGGGDGGLFAGITARYLALVATTLPGDSADDAAARDTARAIVLA
SAQSAWDYRQTVDGLPVFGAFWDREAELPTAGGEQARSVRGAVHSSAIAERDLSVQLSGW
MLMEAAHSAAAVSSLG

Enzyme Prediction     

No EC number prediction in MGYG000002359_00390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	34	333	5.7e-83	0.8240223463687151

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	0.0	5	376	1	377	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	1.74e-27	8	336	3	345	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIH19683.1	1.33e-275	1	376	1	376
BAH24669.1	1.33e-275	1	376	1	376
AMC57837.1	1.33e-275	1	376	1	376
AGQ33909.1	1.33e-275	1	376	1	376
AIH80535.1	1.33e-275	1	376	1	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	4.81e-26	46	365	85	385	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.13e-24	46	365	86	386	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	7.43e-24	46	365	86	386	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	5.76e-14	35	272	31	274	ChainA, Lin0763 protein [Listeria innocua]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002359_00390.