CAZyme Information: MGYG000002359_01233

Basic Information

• Species: Mycobacterium tuberculosis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium tuberculosis
• CAZyme ID: MGYG000002359_01233
• CAZy Family: GT87
• CAZyme Description: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431	MGYG000002359_2|CGC3	47102.43	10.2335

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002359	4387829	Isolate	Sweden	Europe

• Gene Location: Start: 190843; End: 192138 Strand: +

Full Sequence      

MCRTLIDGPVRSAIAKVRQIDTTSSTPAAARRVTSPPARETRAAVLLLVLSVGARLAWTY
LAPNGANFVDLHVYVSGAASLDHPGTLYGYVYADQTPDFPLPFTYPPFAAVVFYPLHLVP
FGLIALLWQVVTMAALYGAVRISQRLMGGTAETGHFAAMLWTAIAIWIEPLRSTFDYGQI
NVLLMLAALWAVYTPRWWLSGLLVGVASGVKLTPAITAVYLVGVRRLHAAAFSVVVFLAT
VGVSLLVVGDEARYYFTDLLGDAGRVGPIATSFNQSWRGAISRILGHDAGFGPLVLAAIA
STAVLAILAWRALDRSDRLGKLLVVELFGLLLSPISWTHHWVWLVPLMIWLIDGPARERP
GARILGWGWLVLTIVGVPWLLSFAQPSIWQIGRPWYLAWAGLVYVVATLATLGWIAASER
YVRIRPRRMAN

Enzyme Prediction     

No EC number prediction in MGYG000002359_01233.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	103	334	1.1e-73	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	0.0	27	431	3	409	mannosyltransferase; Provisional
pfam09594	GT87	2.30e-35	103	334	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALV10344.1	5.65e-314	1	431	1	431
CCG11037.1	5.65e-314	1	431	1	431
SIT99791.1	5.65e-314	1	431	1	431
AMC41238.1	5.65e-314	1	431	1	431
AGL30624.1	5.65e-314	1	431	1	431

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN00	1.13e-314	1	431	1	431	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1
P9WN01	1.13e-314	1	431	1	431	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimE PE=1 SV=1
A0R2K8	3.22e-205	15	420	9	407	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WMZ8	1.38e-31	69	428	45	414	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	1.38e-31	69	428	45	414	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999830	0.000166	0.000002	0.000000	0.000000	0.000006

TMHMM  Annotations     

start	end
43	62
110	132
145	167
177	194
201	223
227	249
290	312
322	344
364	381
396	418