CAZyme Information: MGYG000002359_01619

Basic Information

• Species: Mycobacterium tuberculosis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium tuberculosis
• CAZyme ID: MGYG000002359_01619
• CAZy Family: GT1
• CAZyme Description: putative glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	MGYG000002359_3|CGC1	45696.34	8.762

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002359	4387829	Isolate	Sweden	Europe

• Gene Location: Start: 86488; End: 87768 Strand: -

Full Sequence      

MKFVLAVHGTRGDVEPCAAVGVELRRRGHAVHMAVPPNLIEFVESAGLTGVAYGPDSDEQ
INTVAAFVRNLTRAQNPLNLARAVKELFVEGWAEMGTTLTTLADGADLVMTGQTYHGVAA
NVAEYYDIPAAALHHFPMQVNGQIAIPSIPTPATLVRATMKVSWRLYAYVSKDADRAQRR
ELGLPPAPAPAVRRLAERGAPEIQAYDPVFFPGLAAEWSDRRPFVGPLTMELHSEPNEEL
ESWIAAGTPPIYFGFGSTPVQTPVQTLAMISDVCAQLGERALIYSPAANSTRIRHADHVK
RVGLVNYSTILPKCRAVVHHGGAGTTAAGLRAGMPTLILWDVADQPIWAGAVQRLKVGSA
KRFTNITRGSLLKELRSILAPECAARAREISTRMTRPTAAVTAAADLLEATARQTPGSTP
SSSPGR

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	7	411	3.7e-38	0.9895287958115183

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	1.24e-113	1	419	2	406	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	4.12e-57	1	410	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
TIGR01426	MGT	1.71e-07	12	410	7	388	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam03033	Glyco_transf_28	1.00e-05	3	49	1	49	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMC69764.1	7.08e-310	1	426	1	426
AIH28149.1	7.08e-310	1	426	1	426
AJW49044.1	7.08e-310	1	426	1	426
AIH48307.1	7.08e-310	1	426	1	426
AIH63520.1	7.08e-310	1	426	1	426

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3H4I_A	3.10e-32	1	414	1	384	ChimericGlycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1IIR_A	3.68e-32	1	416	1	403	CrystalStructure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
1RRV_A	1.84e-25	1	416	1	404	X-raycrystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]
1PN3_A	3.96e-21	1	390	1	367	CrystalStructure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PN3_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and the acceptor substrate DVV. [Amycolatopsis orientalis],1PNV_A Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis],1PNV_B Crystal Structure of TDP-epi-Vancosaminyltransferase GtfA in complexes with TDP and Vancomycin [Amycolatopsis orientalis]
5XVM_A	8.05e-15	2	365	21	394	Sterol3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WLV0	1.42e-310	1	426	1	426	Uncharacterized protein MT1577 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1577 PE=4 SV=1
P9WLV1	1.42e-310	1	426	1	426	Uncharacterized protein Rv1526c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1526c PE=4 SV=1
P64870	1.42e-310	1	426	1	426	Uncharacterized protein Mb1553c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1553C PE=4 SV=1
P64866	2.99e-162	1	414	1	412	Uncharacterized glycosyltransferase Mb1551 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=BQ2027_MB1551 PE=3 SV=1
P9WN06	2.99e-162	1	414	1	412	Uncharacterized glycosyltransferase MT1575 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1575 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002359_01619.