CAZyme Information: MGYG000002359_02285

Basic Information

• Species: Mycobacterium tuberculosis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Mycobacterium; Mycobacterium tuberculosis
• CAZyme ID: MGYG000002359_02285
• CAZy Family: GT87
• CAZyme Description: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		47143.13	11.6647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002359	4387829	Isolate	Sweden	Europe

• Gene Location: Start: 144781; End: 146064 Strand: +

Full Sequence      

MSAWRAPEVGSRLGRRVLWCLLWLLAGVALGYVAWRLFGHTPYRIDIDIYQMGARAWLDG
RPLYGGGVLFHTPIGLNLPFTYPPLAAVLFSPFAWLQMPAASVAITVLTLVLLIASTAIV
LTGLDAWPTSRLVPAPARLRRLWLAVLIVAPATIWLEPISSNFAFGQINVVLMTLVIVDC
FPRRTPWPRGLMLGLGIALKLTPAVFLLYFLLRRDGRAALTALASFAVATLLGFVLAWRD
SWEYWTHTLHHTDRIGAAALNTDQNIAGALARLTIGDDERFALWVAGSLLVLAATIWAMR
RVLRAGEPTLAVICVALFGLVVSPVSWSHHWVWMLPAVLVIGLLGWRRRNVALAMLSLAG
VVLMRWTPIDLLPQHRETTAVWWRQLAGMSYVWWALAVIVVAGLTVTARMTPQRSLTRGL
TPAPTAS

Enzyme Prediction     

No EC number prediction in MGYG000002359_02285.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	80	324	2.4e-81	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	4.59e-43	6	415	5	403	mannosyltransferase; Provisional
pfam09594	GT87	7.92e-34	80	324	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.
COG5650	COG5650	2.66e-05	72	238	142	288	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGE68172.1	3.25e-311	1	427	1	427
CCE37652.1	3.25e-311	1	427	1	427
AHJ42952.1	3.25e-311	1	427	1	427
AIH17420.1	3.25e-311	1	427	1	427
AMC86372.1	3.25e-311	1	427	1	427

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMZ8	6.51e-312	1	427	1	427	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	6.51e-312	1	427	1	427	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R036	4.44e-178	1	409	4	418	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
A0R2K8	1.00e-31	45	336	57	333	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WN00	3.55e-31	45	336	69	346	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
17	39
100	122
143	165
190	212
219	238
281	303
310	327
331	346
351	369
389	408