CAZyme Information: MGYG000002361_00775

Basic Information

• Species: Lentilactobacillus senioris
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus senioris
• CAZyme ID: MGYG000002361_00775
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256		28085.92	9.9163

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002361	1566713	Isolate	Japan	Asia

• Gene Location: Start: 127277; End: 128047 Strand: +

Full Sequence      

MKRFGIRLLLTMTVLLGVVAGGESTKAQASVETDFIESIKKPVVSVSHQNHLYASVMMAQ
AILESDWGQSELAVTGNNYFGIKGSYNGQSVTMATAEYSGKGKRYVTNASFKKYPNVTAA
IKDNASLLRHGTDTDSDYYSGTWTDNTVDYRDAAAALSATYATDMAYGNKLTKLIQKYDL
TKLDTSTSSLDIEKQIADSVKDSMNKQSTKTVRSQKEKVVKVPKVDLSNFDKTRATFKND
ASKIKIKPLTPIIKLS

Enzyme Prediction     

No EC number prediction in MGYG000002361_00775.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	43	180	1.3e-29	0.9609375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.49e-46	8	197	11	201	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	6.71e-39	11	184	299	472	amidase domain-containing protein.
PRK06347	PRK06347	5.92e-37	26	189	145	308	1,4-beta-N-acetylmuramoylhydrolase.
smart00047	LYZ2	3.05e-26	34	181	10	142	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.57e-22	40	180	1	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APR08225.1	1.24e-76	27	230	22	229
QOJ84708.1	1.24e-76	27	230	22	229
QOP51469.1	1.24e-76	27	230	22	229
QGV25979.1	3.42e-76	27	230	22	228
AFS00453.1	6.57e-74	23	230	18	229

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.37e-42	35	184	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	2.46e-32	35	184	63	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	9.60e-12	34	177	5	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.27e-11	34	177	5	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	6.43e-33	33	188	181	337	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q2G222	2.68e-31	35	184	323	472	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
A2RHZ5	1.15e-30	35	189	65	219	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	1.48e-30	35	188	65	218	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
P0C2T5	4.22e-30	35	189	65	219	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000342	0.992554	0.006501	0.000221	0.000195	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002361_00775.