CAZyme Information: MGYG000002362_01631

Basic Information

• Species: Fusobacterium_C necrophorum
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_C; Fusobacterium_C necrophorum
• CAZyme ID: MGYG000002362_01631
• CAZy Family: GH13
• CAZyme Description: Glycogen debranching enzyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000002362_13|CGC1	74414.16	6.027

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002362	2094695	Isolate	Spain	Europe

• Gene Location: Start: 6303; End: 8222 Strand: +

Full Sequence      

MHQTIEKNGSSPTFWRTMKPQFSLYAKGAKEVCLEFYQNPEDKTPNKKIVLDTKKNRTGD
YWYFEDSSITEGSLYRWNIDGISILDPLALSYTGNMPVEEKKSIFLLHQQKPVKRLSIPD
KDRLIYEVHIGFFSEKRSYSSFIEKIPYLKELGINTVEFLPIYEWDDYTGNLHPDASPIK
NAWGYNPINFFATTKKYSSSKEAASFSEKEEFHHLVEVLHENGIEVLLDVVYNHTAEGGK
TGYLYNFKAMGENIFYIKTKEKDFANFSGCGNSFNCNHPVAKEMILDSLLYWYYEIGVDG
FRFDLSPVLGRDSDGQWLQHSLLKDLVEHPILSHALLISESWDLGGYFVGALPSGWSEWN
DSYRDTVRKFIRGDFGQIPDLIKRIFGSVDLFHANRKKYQSSINFIACHDGFTMWDLLSY
NRKYNFANGEQNRDGSNENYSYNHGEEGKTDNPTILALRIQQMKNMMLILYISQGIPMLL
MGDEIARTQLGNNNAYCQDNKITWMDWSRKERFQDIFTFTKSMIQLRKSYSIFRREEYLK
MDEEIFLHGVKLHQPDYSFHSLSIAFELFDQETKTRFYIALNSYSETLEFELPILEDGKH
WYLLTDTAKPETSYFQADDMISGKSYPLASKSSMILITK

Enzyme Prediction     

EC	3.2.1.68	3.2.1.-	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	138	488	3.5e-136	0.9914529914529915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1523	PulA	0.0	22	612	34	673	Pullulanase/glycogen debranching enzyme [Carbohydrate transport and metabolism].
cd11326	AmyAc_Glg_debranch	0.0	114	530	7	433	Alpha amylase catalytic domain found in glycogen debranching enzymes. Debranching enzymes facilitate the breakdown of glycogen through glucosyltransferase and glucosidase activity. These activities are performed by a single enzyme in mammals, yeast, and some bacteria, but by two distinct enzymes in Escherichia coli and other bacteria. Debranching enzymes perform two activities: 4-alpha-D-glucanotransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). 4-alpha-D-glucanotransferase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. Amylo-alpha-1,6-glucosidase catalyzes the endohydrolysis of 1,6-alpha-D-glucoside linkages at points of branching in chains of 1,4-linked alpha-D-glucose residues. In Escherichia coli, GlgX is the debranching enzyme and malQ is the 4-alpha-glucanotransferase. TreX, an archaeal glycogen-debranching enzyme has dual activities like mammals and yeast, but is structurally similar to GlgX. TreX exists in two oligomeric states, a dimer and tetramer. Isoamylase (EC 3.2.1.68) is one of the starch-debranching enzymes that catalyzes the hydrolysis of alpha-1,6-glucosidic linkages specific in alpha-glucans such as amylopectin or glycogen and their beta-limit dextrins. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase.
PRK14510	PRK14510	1.18e-123	144	593	191	647	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.
PRK03705	PRK03705	1.34e-120	146	529	185	560	glycogen debranching protein GlgX.
TIGR02104	pulA_typeI	1.91e-73	22	606	23	597	pullulanase, type I. Pullulan is an unusual, industrially important polysaccharide in which short alpha-1,4 chains (maltotriose) are connected in alpha-1,6 linkages. Enzymes that cleave alpha-1,6 linkages in pullulan and release maltotriose are called pullulanases although pullulan itself may not be the natural substrate. This family consists of pullulanases related to the subfamilies described in TIGR02102 and TIGR02103 but having a different domain architecture with shorter sequences. Members are called type I pullulanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV95071.1	0.0	1	639	1	639
AVQ21245.1	0.0	1	639	1	639
AYV92939.1	0.0	1	639	1	639
AZW09477.1	0.0	1	639	1	639
AYZ74637.1	0.0	1	639	1	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VNC_A	6.55e-121	22	540	33	601	Crystalstructure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VNC_B Crystal structure of Glycogen Debranching enzyme TreX from Sulfolobus solfataricus [Saccharolobus solfataricus],2VR5_A Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VR5_B Crystal structure of Trex from Sulfolobus Solfataricus in complex with acarbose intermediate and glucose [Saccharolobus solfataricus],2VUY_A Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],2VUY_B Crystal structure of Glycogen Debranching exzyme TreX from Sulfolobus solfatarius [Saccharolobus solfataricus],7EAV_A Chain A, Glycogen debranching enzyme [Saccharolobus solfataricus],7EAV_B Chain B, Glycogen debranching enzyme [Saccharolobus solfataricus]
4J7R_A	2.13e-100	22	638	78	811	CrystalStructure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4J7R_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) [Chlamydomonas reinhardtii],4OKD_A Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii],4OKD_B Crystal Structure of Chlamydomonas reinhardtii Isoamylase 1 (ISA1) in complex with maltoheptaose [Chlamydomonas reinhardtii]
2WSK_A	5.19e-87	146	528	185	559	Crystalstructure of Glycogen Debranching Enzyme GlgX from Escherichia coli K-12 [Escherichia coli K-12]
1BF2_A	3.60e-66	121	639	177	750	StructureOf Pseudomonas Isoamylase [Pseudomonas amyloderamosa]
2WAN_A	1.38e-46	22	534	329	831	Pullulanasefrom Bacillus acidopullulyticus [Bacillus acidopullulyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9M0S5	1.00e-129	22	639	104	764	Isoamylase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISA3 PE=1 SV=2
B9G434	2.69e-123	22	639	119	781	Isoamylase 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ISA3 PE=2 SV=1
O22637	2.07e-120	22	639	99	786	Isoamylase SU1, chloroplastic OS=Zea mays OX=4577 GN=SU1 PE=1 SV=1
D0TZF0	2.26e-119	22	636	115	797	Isoamylase 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=ISA1 PE=1 SV=1
O04196	1.73e-116	22	637	88	776	Isoamylase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002362_01631.