CAZyme Information: MGYG000002363_00728

Basic Information

• Species: Raoultella ornithinolytica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Raoultella; Raoultella ornithinolytica
• CAZyme ID: MGYG000002363_00728
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
400	MGYG000002363_5|CGC3	44815.7	5.9423

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002363	5677722	Isolate	United Republic of Tanzania	Africa

• Gene Location: Start: 215434; End: 216636 Strand: +

Full Sequence      

MKRLTPALLAVCLACSFSPAALAAEALQTRAFRALPADFIKGADISTLLDAEKHGAKFYN
HNNQQQDPIAILKADGVNYVRLRLWVDPKDAQGQGYGGGDNDLAATLALAKRAKAQGMKL
LLDFHYSDFWTDPGKQFKPKAWEKMDYPQLKTTIHDYTRDTIARFKQEGVLPDMVQIGNE
INGGMLWPEGKSWGQGGGEFDRLAGLLNAAIDGLKENLQNGEQVKIMLHLAEGTKNDTFR
WWFDEISKRNVPYDIIGLSMYTYWNGPISALKANMDDISRRYNKDVIVVEAAYAYTLENC
DNAENSFQAKEEKEGGYPATVQGQYNYIHDLMQAVADVPDQRGKGIFYWEPTWIAVPGNT
WATPAGMKYIHDEWKQGNARENQALFDCQGKVLPSAKVFN

Enzyme Prediction     

No EC number prediction in MGYG000002363_00728.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	40	399	1.3e-148	0.9970760233918129

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3867	GanB	0.0	1	400	2	392	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	1.50e-146	40	399	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSA10671.1	4.19e-307	1	400	1	400
VEC75736.1	4.19e-307	1	400	1	400
QQO51178.1	4.19e-307	1	400	1	400
AOO57232.1	4.19e-307	1	400	1	400
AXC31528.1	4.19e-307	1	400	1	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	4.87e-101	35	399	46	391	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	8.88e-94	38	399	23	388	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	7.08e-93	38	399	23	388	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	8.22e-60	41	399	5	329	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	2.09e-56	41	366	5	320	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65CX5	1.03e-92	38	399	48	413	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
P48843	1.79e-90	39	395	6	342	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
O07013	1.67e-86	22	399	36	417	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P48841	3.76e-59	39	399	27	365	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
P83692	4.50e-59	41	399	5	329	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000569	0.799439	0.199173	0.000278	0.000279	0.000239

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002363_00728.