CAZyme Information: MGYG000002363_03792

Basic Information

• Species: Raoultella ornithinolytica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Raoultella; Raoultella ornithinolytica
• CAZyme ID: MGYG000002363_03792
• CAZy Family: PL22
• CAZyme Description: Oligogalacturonate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000002363_15|CGC4	44340.6	5.6332

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002363	5677722	Isolate	United Republic of Tanzania	Africa

• Gene Location: Start: 331040; End: 332215 Strand: +

Full Sequence      

MAKGMRVKLNYEVSRDPDTGAEITRLTPPEVTCHRNYFYQKCFFNDGSHLLFAGEFDGHW
NYYLLNIATAEAVQLTEGAGDNTFGGFLSPDDSALYYVKNDRTLLEVNLSTLQERQVYRV
PDEWVGYGTWVANSDCSKLVGIEIAKSDWTPLNDWQIFHDFFHKGPHCRLLRVDLQSGES
RVIHEEKKWLGHPIYRPFDDNTVAFCHEGPHDLVDARMWMVNEDGSHVRKVKEHAEGESC
THEFWVPNGSALIYVSYLKGQQGRTIYRFDPDTGINTALMQMPACSHLMSNFDGTLLVGD
GSGTPVDVKDTSGYTIDNDPYLYVFDVAKQAYFRVARHDTSWATVANSRQVTHPHPSFTP
DDRAILFSSDKDGKPAIYIAKLPAHPEMLQA

Enzyme Prediction     

EC	4.2.2.6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL22	215	383	1.1e-81	0.6339622641509434
PL22	33	138	4.1e-30	0.9716981132075472

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14583	Pectate_lyase22	0.0	1	384	1	384	Oligogalacturonate lyase. This is a family of oligogalacturonate lyases, referred to more generally as pectate lyase family 22. These proteins fold into 7-bladed beta-propellers.
COG0823	TolB	1.29e-29	15	362	72	402	Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking, secretion, and vesicular transport].
PRK00178	tolB	5.61e-10	245	378	206	314	Tol-Pal system protein TolB.
PRK04792	tolB	4.92e-09	245	378	225	333	Tol-Pal system protein TolB.
PRK01029	tolB	9.59e-08	218	388	167	316	Tol-Pal system protein TolB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXC28817.1	2.51e-308	1	391	1	391
AGJ89329.1	2.51e-308	1	391	1	391
QQQ07196.1	2.51e-308	1	391	1	391
VEB66592.1	2.51e-308	1	391	1	391
QLK20095.1	2.51e-308	1	391	1	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PE7_A	2.66e-212	1	383	1	383	Oligogalacturonatelyase in complex with manganese [Yersinia enterocolitica subsp. enterocolitica 8081]
3C5M_A	1.42e-190	2	383	2	383	Crystalstructure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_B Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633],3C5M_C Crystal structure of oligogalacturonate lyase (VPA0088) from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR199 [Vibrio parahaemolyticus RIMD 2210633]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P21258	1.13e-208	1	383	1	383	Oligogalacturonate lyase OS=Dickeya dadantii (strain 3937) OX=198628 GN=ogl PE=2 SV=2
Q59418	2.94e-204	1	383	1	383	Oligogalacturonide lyase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=ogl PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999742	0.000261	0.000008	0.000002	0.000001	0.000004

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002363_03792.