CAZyme Information: MGYG000002366_01099

Basic Information

• Species: Salmonella enterica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Salmonella; Salmonella enterica
• CAZyme ID: MGYG000002366_01099
• CAZy Family: GT1
• CAZyme Description: Elloramycin glycosyltransferase ElmGT

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000002366_1|CGC15	40133.27	6.7715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002366	4955431	Isolate	United States	North America

• Gene Location: Start: 1149572; End: 1150687 Strand: -

Full Sequence      

MRILFVGPPLYGLLYPVLSLAQAFRVNGHEVLIASGGKFAQKAAEAGLVVFDAAPGFDSE
AGYRRQEALRKENNIGTKMGNFSFFSEEMTDPLVAFVGQWRPDLIVYPPLGVVGPLIAAK
YDIPVVMQTVGFGHTPWHIKGVTKSLSNAYRRHGVSAPPRDLAWIDVTPPSMSILQNDGE
PVISMQYVPYNGGAVWEEWWERTPDRKRLLVSLGTVKPMVDGLDLISWVMDSAGEVDAEI
ILHLPANARSDLRSLPPNVRLVDWLPMGVFLNGADGFIHHGGAGNTLTALHAGIPQIVFG
QGADRPVNARAVVERGCGIIPGKSGLTSSMINTFLGNRALREASQEVAAEMAAQPCPTEV
AKKLIAMLQHG

Enzyme Prediction     

No EC number prediction in MGYG000002366_01099.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	94	366	3.5e-33	0.6832460732984293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	3.38e-89	1	371	2	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	5.89e-50	1	364	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
pfam06722	DUF1205	3.04e-44	165	260	1	95	Protein of unknown function (DUF1205). This family represents a conserved region of unknown function within bacterial glycosyl transferases. Many family members contain pfam03033.
TIGR01426	MGT	6.57e-29	9	348	4	357	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam00201	UDPGT	3.13e-05	255	319	320	386	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMZ06295.1	1.49e-274	1	371	1	371
AKF90385.2	1.49e-274	1	371	1	371
ALO90584.1	1.49e-274	1	371	1	371
AMY73538.1	1.49e-274	1	371	1	371
AHW16503.1	1.49e-274	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AMB_A	4.30e-59	1	367	23	398	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMB_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
4AMG_A	3.31e-58	1	367	23	398	Crystalstructure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AMG_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_A Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_B Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_C Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater],4AN4_D Crystal structure of the glycosyltransferase SnogD from Streptomyces nogalater [Streptomyces nogalater]
3D0R_A	8.27e-54	1	365	21	393	Crystalstructure of calG3 from Micromonospora echinospora determined in space group P2(1) [Micromonospora echinospora],3D0R_B Crystal structure of calG3 from Micromonospora echinospora determined in space group P2(1) [Micromonospora echinospora],3OTI_A Crystal Structure of CalG3, Calicheamicin Glycostyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3OTI_B Crystal Structure of CalG3, Calicheamicin Glycostyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3D0Q_A	1.96e-50	2	365	22	393	Crystalstructure of calG3 from Micromonospora echinospora determined in space group I222 [Micromonospora echinospora],3D0Q_B Crystal structure of calG3 from Micromonospora echinospora determined in space group I222 [Micromonospora echinospora]
3WAD_A	6.72e-31	14	371	14	416	Crystalstructure of glycosyltransferase VinC involved in the biosynthesis of vicenistatin [Streptomyces halstedii],3WAD_B Crystal structure of glycosyltransferase VinC involved in the biosynthesis of vicenistatin [Streptomyces halstedii],3WAG_A Crystal structure of glycosyltransferase VinC in complex with DTDP [Streptomyces halstedii],3WAG_B Crystal structure of glycosyltransferase VinC in complex with DTDP [Streptomyces halstedii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2V630	2.37e-240	1	371	1	371	Enterobactin C-glucosyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=iroB PE=1 SV=2
Q9F2F9	2.03e-49	1	364	1	369	Elloramycin glycosyltransferase ElmGT OS=Streptomyces olivaceus OX=47716 GN=elmGT PE=1 SV=2
Q9ZGH7	8.55e-32	15	364	15	410	10-deoxymethynolide desosaminyltransferase OS=Streptomyces venezuelae OX=54571 GN=desVII PE=1 SV=1
A4F7P3	2.59e-29	1	360	1	406	3-alpha-mycarosylerythronolide B desosaminyl transferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=eryCIII PE=1 SV=1
Q9L9F5	5.12e-29	1	366	1	371	L-demethylnoviosyl transferase OS=Streptomyces niveus OX=193462 GN=novM PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995436	0.004497	0.000080	0.000012	0.000005	0.000011

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002366_01099.