CAZyme Information: MGYG000002366_01824

Basic Information

• Species: Salmonella enterica
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Salmonella; Salmonella enterica
• CAZyme ID: MGYG000002366_01824
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
204	MGYG000002366_1|CGC24	22250.27	9.5963

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002366	4955431	Isolate	United States	North America

• Gene Location: Start: 1918239; End: 1918853 Strand: +

Full Sequence      

MNESQFQQAAGISAELAARWFPHIDAAMKEFGITAPADQAMFIAQVGHESMGFSAVVENF
NYTPSALVATFGKRITQQQADALGRTSGHAARQDAIANLVYSNRLGNKAPGDGWKYRGRG
LIQITGLHNYRICGAALKLDLVTSPEQLEQELQAARSAAWFYTSKGCMIYGADINRVTRI
INGGLNGIEDRKVRYNKARAALLV

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	17	165	1.3e-32	0.5064935064935064

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	8.69e-76	1	203	4	205	Predicted chitinase [General function prediction only].
cd00325	chitinase_GH19	9.65e-09	3	196	3	205	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	2.82e-06	17	185	33	198	Chitinase class I.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDL22507.1	7.27e-146	1	204	1	204
AMY87902.1	7.27e-146	1	204	1	204
QPD10906.1	7.27e-146	1	204	1	204
ACF90575.1	7.27e-146	1	204	1	204
QPD15375.1	7.27e-146	1	204	1	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	4.94e-85	1	202	16	222	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
2CJL_A	3.87e-06	38	185	46	170	CrystalStructure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	1.01e-28	21	195	14	191	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	4.07e-11	8	200	187	359	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000027	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002366_01824.