CAZyme Information: MGYG000002367_00938

Basic Information

• Species: Pediococcus pentosaceus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Pediococcus; Pediococcus pentosaceus
• CAZyme ID: MGYG000002367_00938
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000002367_6|CGC3	41178.92	9.6282

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002367	1751049	Isolate	China	Asia

• Gene Location: Start: 263289; End: 264413 Strand: +

Full Sequence      

MKKLNKLKWVVAIAAAFFIGATFNSKVSAATINNDYALSSNQGSSLRTSNNVIIAHATAV
YAPARNVAIFENRTWYSNGAYVQYIVGDGGKIYRVGAEGYQAWGAGSWANANAPVQIELA
QTYDNAEFHKDYVTYVNLLRSSAIKYGIPTDVDSSAWRGVKSHLWITNHVWGDHTDPYGY
LASHGITKAQFAHDVKYGFSSSGNNVNPTPTPTPKPSTPTNKKAVHVTYALHQKGKKWLN
PVKDFGSGSNGFAGVPNSVHDMLYIKVNHGNIKYRVHTIEDGWLPWVHKANKNDTVNGVA
GIKGHTIDGVQMYYTTPSGETYQQSYYRSQTTQRANYLGTCADNGSVSGYDNFAGMLGEP
LDRLQIHINNYSKY

Enzyme Prediction     

No EC number prediction in MGYG000002367_00938.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06583	PGRP	8.72e-13	53	180	5	126	Peptidoglycan recognition proteins (PGRPs) are pattern recognition receptors that bind, and in certain cases, hydrolyze peptidoglycans (PGNs) of bacterial cell walls. PGRPs have been divided into three classes: short PGRPs (PGRP-S), that are small (20 kDa) extracellular proteins; intermediate PGRPs (PGRP-I) that are 40-45 kDa and are predicted to be transmembrane proteins; and long PGRPs (PGRP-L), up to 90 kDa, which may be either intracellular or transmembrane. Several structures of PGRPs are known in insects and mammals, some bound with substrates like Muramyl Tripeptide (MTP) or Tracheal Cytotoxin (TCT). The substrate binding site is conserved in PGRP-LCx, PGRP-LE, and PGRP-Ialpha proteins. This family includes Zn-dependent N-Acetylmuramoyl-L-alanine Amidase, EC:3.5.1.28. This enzyme cleaves the amide bond between N-acetylmuramoyl and L-amino acids, preferentially D-lactyl-L-Ala, in bacterial cell walls. The structure for the bacteriophage T7 lysozyme shows that two of the conserved histidines and a cysteine are zinc binding residues. Site-directed mutagenesis of T7 lysozyme indicates that two conserved residues, a Tyr and a Lys, are important for amidase activity.
pfam01510	Amidase_2	2.78e-11	51	177	3	119	N-acetylmuramoyl-L-alanine amidase. This family includes zinc amidases that have N-acetylmuramoyl-L-alanine amidase activity EC:3.5.1.28. This enzyme domain cleaves the amide bond between N-acetylmuramoyl and L-amino acids in bacterial cell walls (preferentially: D-lactyl-L-Ala). The structure is known for the bacteriophage T7 structure and shows that two of the conserved histidines are zinc binding.
smart00644	Ami_2	1.68e-09	52	169	5	123	Ami_2 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABJ67868.1	1.08e-104	1	374	1	438
QGZ70144.1	9.97e-103	1	374	1	416
QYY85690.1	4.79e-99	1	374	1	421
QYY86091.1	4.20e-91	1	374	1	419
APR28090.1	2.62e-89	219	374	287	442

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IVV_A	1.78e-17	81	200	53	175	Catalyticamidase domain of the major autolysin LytA from Streptococcus pneumaniae [Streptococcus pneumoniae TIGR4]
4X36_A	1.94e-16	81	200	51	173	Crystalstructure of the autolysin LytA from Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae TIGR4]
5CTV_A	4.19e-16	81	200	53	175	Catalyticdomain of LytA, the major autolysin of Streptococcus pneumoniae, (C60A, H133A, C136A mutant) complexed with peptidoglycan fragment [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q38135	9.48e-31	36	238	8	213	N-acetylmuramoyl-L-alanine amidase OS=Lactococcus phage r1t OX=43685 PE=3 SV=1
Q38653	2.41e-25	51	195	23	170	Endolysin OS=Listeria phage A511 OX=40523 GN=PLY511 PE=2 SV=1
P06653	1.44e-15	81	200	51	173	Autolysin OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytA PE=1 SV=2
P32762	2.20e-14	91	202	60	175	Lytic amidase OS=Streptococcus pneumoniae phage HB-3 OX=10728 GN=HBL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000593	0.998399	0.000285	0.000271	0.000231	0.000211

TMHMM  Annotations     

start	end
7	24