CAZyme Information: MGYG000002367_01452

Basic Information

• Species: Pediococcus pentosaceus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Pediococcus; Pediococcus pentosaceus
• CAZyme ID: MGYG000002367_01452
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
214		24504.59	9.7847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002367	1751049	Isolate	China	Asia

• Gene Location: Start: 148596; End: 149240 Strand: -

Full Sequence      

MAKRKRRRKSSSFYNRGQLHVSNLIGVLLALCLIVAISMKLYVTQHNVVDDSVATEASND
AQHQQFIKTIGPYAQQMQRQYGILPSITMAQAILESDWGQSTLSKKFNNYYGIKGDSDSN
SRYFKTQEFVNGRWVTVSARFRVYSSWQESMRDHSLLLVNGTNWNSQQYQAVINAADYKQ
AAQALYDAQYATDPDYPSKLINLIQKYGLNNYDK

Enzyme Prediction     

No EC number prediction in MGYG000002367_01452.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	71	209	1.3e-36	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.15e-66	23	214	3	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	9.11e-38	63	213	8	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	1.84e-37	64	213	161	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK08581	PRK08581	4.26e-37	62	214	319	473	amidase domain-containing protein.
PRK05684	flgJ	6.51e-32	64	206	153	296	flagellar assembly peptidoglycan hydrolase FlgJ.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANI98522.1	2.07e-150	1	214	1	214
QHO67103.1	2.07e-150	1	214	1	214
QYY86746.1	2.07e-150	1	214	1	214
QHM67511.1	2.07e-150	1	214	1	214
QHM68335.1	2.07e-150	1	214	1	214

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	4.06e-30	50	213	17	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	7.95e-23	50	213	47	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.18e-17	66	206	6	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.64e-17	66	206	6	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.44e-43	27	214	11	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	1.67e-27	66	213	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
P0C2T5	5.98e-27	66	213	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
A2RHZ5	5.98e-27	66	213	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P39046	6.63e-23	66	213	65	214	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999982	0.000048	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
21	43