CAZyme Information: MGYG000002368_01411

Basic Information

• Species: Vibrio metoecus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio metoecus
• CAZyme ID: MGYG000002368_01411
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
962	MGYG000002368_11|CGC1	106528.58	6.6326

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002368	3946363	Isolate	United States	North America

• Gene Location: Start: 13445; End: 16333 Strand: -

Full Sequence      

MARLQFLLQVDGLEDESLVVRGFEGQESLSDSVWRSEPCYGFRYQVDLASALSNLTAEQF
VDQTAHLTILRDGQVVQQINGIVRQFSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQ
QNVPEIISILLQEMGIEDYAFALKRECARREFCVQYRETDLQFLHRIAAEEGLVYSHLHE
AQKHTLLFTDSSDSQPKLAKPVPYNALAGGEINLPYVVDLQFKTTAQVSHTELKDYSFKK
PAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFSQIRLEYLRRDALLADAKSDE
PLLLAGVRFDLQDHLDLAMNRDWLVVQANHQGTQPQALQEEGGSGSTTYSNQLKLIPAHI
TWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQ
EWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTE
THQGQGYNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRN
QHLTVEGEVRSKIALDSSHEVGASLQHKVGQRIAVEAGKEISLKCGAKIVVEAGAELTLK
AGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAAAPRMLAQAKPVAELVQPDIA
ASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTSERILKSDLLKPSDELEKLAKR
QASAYREGNHRDEVKLLQQALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHP
SYSIGAVDGIVGKGTLLALDEALMDGWVYLLITKDMLNVVCPNSGNNKELLDSLNKYCPM
YEIDTPIRIAHFLSQIAHESGCFSSLTEGSNYSHMAAKLKFSKYRSYVDSLKSGSTNKFI
REDNPARCKQPDLFNFVYSSSNGNGDEKSGDGYKYRGRGLIQITGKDKYSRFTSVHNSKK
SG

Enzyme Prediction     

No EC number prediction in MGYG000002368_01411.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3501	VgrG	0.0	3	549	11	540	Uncharacterized conserved protein, implicated in type VI secretion and phage assembly [Intracellular trafficking, secretion, and vesicular transport, Mobilome: prophages, transposons, General function prediction only].
TIGR03361	VI_Rhs_Vgr	0.0	6	526	1	513	type VI secretion system Vgr family protein. Members of this protein family belong to the Rhs element Vgr protein family (see TIGR01646), but furthermore all are found in genomes with type VI secretion loci. However, members of this protein family, although recognizably correlated to type VI secretion according the partial phylogenetic profiling algorithm, are often found far the type VI secretion locus.
TIGR01646	vgr_GE	3.97e-139	18	508	1	483	Rhs element Vgr protein. This model represents the Vgr family of proteins, associated with some classes of Rhs elements. This model does not include a large octapeptide repeat region, VGXXXXXX, found in the Vgr of Rhs classes G and E.
pfam05954	Phage_GPD	2.46e-82	26	336	1	305	Phage late control gene D protein (GPD). This family includes a number of phage late control gene D proteins and related bacterial sequences. This family also includes Bacteriophage Mu P proteins and related sequences.
COG3179	COG3179	9.53e-27	815	953	8	134	Predicted chitinase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATD28782.1	0.0	1	959	1	959
AMG01858.1	0.0	1	959	1	959
AOW84609.1	0.0	1	959	1	959
AHX36826.1	0.0	1	808	1	808
QXC56125.1	0.0	1	808	1	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q5P_A	1.11e-93	42	528	36	534	ChainA, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5],7Q5P_B Chain B, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5],7Q5P_C Chain C, Type VI secretion protein VgrG [Pseudomonas protegens Pf-5]
4MTK_A	7.61e-92	3	523	2	518	Crystalstructure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_B Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_C Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_D Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_E Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],4MTK_F Crystal structure of PA0091 VgrG1, the central spike of the Type VI Secretion System [Pseudomonas aeruginosa PAO1],6H3L_A Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3L_B Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3L_C Structure of VgrG1 in the Type VI secretion 'pre-firing' VgrG1-Tse6-EagT6-EF-Tu-Tsi6 complex [Pseudomonas aeruginosa PAO1],6H3N_A Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1],6H3N_B Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1],6H3N_C Structure of VgrG1 in the Type VI secretion VgrG1-Tse6-EF-Tu complex embedded in lipid nanodiscs [Pseudomonas aeruginosa PAO1]
4UHV_A	4.76e-90	3	523	2	518	Thestructure of VgrG1, the needle tip of the bacterial Type VI Secretion System [Pseudomonas aeruginosa PAO1],4UHV_B The structure of VgrG1, the needle tip of the bacterial Type VI Secretion System [Pseudomonas aeruginosa PAO1]
4NSO_A	3.04e-42	732	809	16	93	Crystalstructure of the effector-immunity protein complex [Vibrio cholerae O1 biovar El Tor str. N16961]
6SJL_A	2.34e-27	17	503	30	517	Structureof the Tle1 effector bound to the VgrG spike from the Type 6 secretion system [Escherichia coli],6SJL_B Structure of the Tle1 effector bound to the VgrG spike from the Type 6 secretion system [Escherichia coli],6SJL_C Structure of the Tle1 effector bound to the VgrG spike from the Type 6 secretion system [Escherichia coli],6SK0_A The VgrG spike from the Type 6 secretion system [Escherichia coli],6SK0_B The VgrG spike from the Type 6 secretion system [Escherichia coli],6SK0_C The VgrG spike from the Type 6 secretion system [Escherichia coli],6SKI_A The Tle hydrolase bound to the TTR domain of the VgrG spike of the Type 6 secretion system [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9KN42	0.0	1	809	1	809	Type VI secretion system spike protein VgrG3 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=vgrG3 PE=1 SV=1
Q9KNE7	1.11e-302	1	665	1	665	Type VI secretion system spike protein VgrG2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=vgrG2 PE=3 SV=1
Q9KS45	8.75e-288	1	657	1	654	Actin cross-linking toxin VgrG1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=vgrG1 PE=1 SV=1
A0A0H3AIG7	6.62e-284	1	657	1	638	Actin cross-linking toxin VgrG1 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=vgrG1 PE=1 SV=1
K7WKL8	3.42e-188	4	637	7	635	Type VI secretion system spike protein VgrG1 OS=Aeromonas hydrophila OX=644 GN=vgrG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999702	0.000347	0.000003	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002368_01411.