CAZyme Information: MGYG000002368_01570

Basic Information

• Species: Vibrio metoecus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio metoecus
• CAZyme ID: MGYG000002368_01570
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	MGYG000002368_13|CGC2	34022.2	5.7246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002368	3946363	Isolate	United States	North America

• Gene Location: Start: 31611; End: 32531 Strand: -

Full Sequence      

MWQKVWAIGCAWVISYGVNAAVFELPVEGSSIVGNTQYHEIQKGQTLSDIAKQYDIGLLA
LMAANRGVDPFLPQEGFVLAIPAQIILPKIPYEGIVINLAELRLYYFRPDEGKVYIFPVG
IGRIGRDTPVMQTSISSKRKNPTWTPPESIRREHKAKGDILPAVVPAGPDNPLGDYAMRL
AYGSGEYLIHGTNKDFGIGMRVSSGCIRMDPKDIEWLFQQVERGEKVRIINEPIKVALEP
DRSVFIEVHEPLTRSDGVKHALVMPQELSWWLDENKVSDAKARAAILAQNGVPVEIAPPV
WESAEQ

Enzyme Prediction     

No EC number prediction in MGYG000002368_01570.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10260	PRK10260	3.87e-93	19	296	23	305	L,D-transpeptidase; Provisional
PRK10190	PRK10190	2.14e-84	14	299	15	305	L,D-transpeptidase; Provisional
COG1376	ErfK	2.21e-49	17	233	20	232	Lipoprotein-anchoring transpeptidase ErfK/SrfK [Cell wall/membrane/envelope biogenesis].
cd16913	YkuD_like	2.13e-40	95	230	2	121	L,D-transpeptidases/carboxypeptidases similar to Bacillus YkuD. Members of the YkuD-like family of proteins are found in a range of bacteria. The best studied member Bacillus YkuD has been shown to act as an L,D-transpeptidase that gives rise to an alternative pathway for peptidoglycan cross-linking. Another member Helicobacter pylori Csd6 functions as an L,D-carboxypeptidase and regulates helical cell shape and motility. The conserved region contains a conserved histidine and cysteine, with the cysteine thought to be an active site residue.
pfam17969	Ldt_C	4.58e-25	233	296	1	67	L,D-transpeptidase C-terminal domain. This is the C-terminal domain found in d-transpeptidases (Ldt) homologues from E.coli. Three of these enzymes (YbiS, ErfK, YcfS) have been shown to cross-link Braun's lipoprotein to the peptidoglycan (PG), while the other two (YnhG, YcbB) form direct meso-diaminopimelate (DAP-DAP, or 3-3) cross-links within the PG. Family members include erfK (ldtA), ybiS (ldtB), ycfS (ldtC), and ynhG (ldtE).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXC55304.1	1.06e-207	1	306	1	306
QUY00823.1	4.06e-196	1	306	1	306
QPC55488.1	4.06e-196	1	306	1	306
QTV10206.1	4.06e-196	1	306	1	306
QLK92159.1	4.06e-196	1	306	1	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LZH_A	3.96e-72	19	296	2	284	ChainA, L,D-transpeptidase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75954	1.02e-88	2	296	10	310	Probable L,D-transpeptidase YcfS OS=Escherichia coli (strain K12) OX=83333 GN=ycfS PE=1 SV=1
P76193	1.01e-78	7	296	17	302	Probable L,D-transpeptidase YnhG OS=Escherichia coli (strain K12) OX=83333 GN=ynhG PE=1 SV=1
P39176	5.66e-75	20	296	21	302	Probable L,D-transpeptidase ErfK/SrfK OS=Escherichia coli (strain K12) OX=83333 GN=erfK PE=1 SV=2
P0AAX8	7.08e-75	19	257	23	261	Probable L,D-transpeptidase YbiS OS=Escherichia coli (strain K12) OX=83333 GN=ybiS PE=1 SV=1
P0AAX9	7.08e-75	19	257	23	261	Probable L,D-transpeptidase YbiS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=ybiS PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000416	0.998756	0.000289	0.000167	0.000179	0.000172

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002368_01570.