CAZyme Information: MGYG000002368_02791

Basic Information

• Species: Vibrio metoecus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Vibrio; Vibrio metoecus
• CAZyme ID: MGYG000002368_02791
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
242		28466.87	9.0979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002368	3946363	Isolate	United States	North America

• Gene Location: Start: 25087; End: 25815 Strand: -

Full Sequence      

MKIYVISLKNSLDRRASIEQQMTSHGLKFEFFDAIDGRIDPPHPLFANYDYTKRLWLTSG
KMPMRGELGCYASHYLMWQKCVEFNAPIVVLEDDVIINENFPQYLSIIKDKTNEYGFLRL
EPEVGKCRLFSKESKENYSIAFMDNNWGGTRAYSISPDSARKLILGSQKWSMAVDNYIGC
TYIHKMPSYIFSPSMVEHGVEFETTFQNEKRIRVPLYRKPTREIYSVYKKIRIMMFANEY
KK

Enzyme Prediction     

No EC number prediction in MGYG000002368_02791.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	2	177	1.9e-41	0.9779005524861878

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01755	Glyco_transf_25	9.14e-45	2	178	3	200	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.
cd06532	Glyco_transf_25	1.86e-42	2	178	1	128	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
COG3306	COG3306	4.64e-32	1	242	3	253	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAL77358.1	1.63e-179	1	242	1	242
QKU71815.1	1.63e-179	1	242	1	242
QKU75763.1	1.63e-179	1	242	1	242
AYC06486.1	7.47e-176	1	242	1	242
SYZ82551.1	2.74e-130	1	242	1	242

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57394	6.00e-12	4	163	5	166	Lipooligosaccharide biosynthesis protein lic2B OS=Haemophilus influenzae OX=727 GN=lic2B PE=3 SV=1
Q57125	9.86e-10	4	184	35	213	Putative glycosyltransferase HI_0765 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0765 PE=3 SV=1
Q50950	1.32e-09	1	202	1	211	Lacto-N-neotetraose biosynthesis glycosyltransferase LgtE OS=Neisseria gonorrhoeae OX=485 GN=lgtE PE=3 SV=1
Q17FB8	3.34e-09	3	164	325	490	Glycosyltransferase 25 family member OS=Aedes aegypti OX=7159 GN=AAEL003481 PE=3 SV=1
Q03974	1.71e-08	5	164	8	193	Lipooligosaccharide biosynthesis protein lex-1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=lex1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002368_02791.