CAZyme Information: MGYG000002369_00221

Basic Information

• Species: Clostridioides difficile
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Clostridioides; Clostridioides difficile
• CAZyme ID: MGYG000002369_00221
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
713		85224.14	5.5991

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002369	4190038	Isolate	United States	North America

• Gene Location: Start: 199027; End: 201168 Strand: +

Full Sequence      

MLLSIVMIVKNEEKILEKTLKSLTTLRSSIESELIIVDTGSTDDTINISRKYTENVYFHN
WNNDFSSMRNISISYAKGEWLLILDADEILIDSSTIVKFFKDGLDKKFNSASIQLKNLYS
YDKKLYGYCSVLRLFKNIDFRYHGKVHEQPIYKNPIFNNVADFEHYGYLFEDEEIRLNKV
KRNEKLLFEELKENDNSPYTNYQLGKNFIILGKYHEALYYLEKSYELYSKLESAPGYLIT
SLVKTYLYLGKHKKCEKLCLKYIKKDMNNIDIYYYIAQAQVDLGKYENSIDSYKRYIYLL
DNYEISTQANSLFSDTDTVGLRDEAIITLIKIYYKLEKYESVISEYNNIEDMEKKKNVYF
SLFMSLYKLNRFEDIKNYYKEVSNSKIEKNSFYKNIEEVINNIKDDEKEHVYKILCDIEG
NYGILNQIRINKCVSIDKCKEILNEEKEIIYAYIIKVAFEDKIDLLDIFYEMEYVWIEKY
LKYLLALERSFNLVLYKYIISRPNTSDIKKIRVYKAISKVVLESISLSDEKYKEIFYLYI
MYSYKYIRYIYRNLSDFELIKFVCNDLDKFTIEFKHLLDIKNKVNDANEKLEYIHSMRKL
LNEYPFYNKIIKILISELEENIKESEEFKDLKDSFIISIENMIETGKINDAKSLVDDYSK
TFMDDVKILNIKGILYMFENKLDKADFMLKKALSLDVENEDTIYNIEYLKSLR

Enzyme Prediction     

No EC number prediction in MGYG000002369_00221.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	90	6.4e-17	0.5352941176470588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	6.68e-33	3	222	2	221	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
pfam00535	Glycos_transf_2	3.69e-15	4	103	1	106	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
TIGR04195	S_glycosyl_SunS	2.25e-14	7	358	63	407	peptide S-glycosyltransferase, SunS family. Members of this family include SunS, the S-glycosyltransferase that transfers a sugar (substrate is variable in reconstitution assays) onto the precursor of the glycopeptide sublancin, which once was thought to be a lantibiotic.
cd02525	Succinoglycan_BP_ExoA	6.00e-13	4	102	3	108	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd00761	Glyco_tranf_GTA_type	2.64e-12	5	90	1	90	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUP84171.1	0.0	1	713	1	713
AYD26936.1	0.0	1	713	1	713
QPK95031.1	0.0	1	713	1	713
AVB39418.1	0.0	1	713	1	713
AVB51701.1	0.0	1	713	1	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MSN_A	3.42e-18	8	358	61	402	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSN_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]
7MSP_A	4.78e-17	8	238	61	291	ChainA, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168],7MSP_B Chain B, SPbeta prophage-derived glycosyltransferase SunS [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31986	1.87e-17	8	358	61	402	SPbeta prophage-derived glycosyltransferase SunS OS=Bacillus subtilis (strain 168) OX=224308 GN=sunS PE=1 SV=1
O64036	1.87e-17	8	358	61	402	Glycosyltransferase SunS OS=Bacillus phage SPbeta OX=66797 GN=sunS PE=3 SV=1
P42460	1.86e-08	4	91	11	94	TPR repeat-containing protein Synpcc7942_0270 OS=Synechococcus elongatus (strain PCC 7942 / FACHB-805) OX=1140 GN=Synpcc7942_0270 PE=4 SV=1
Q9XC90	4.28e-07	3	88	5	85	Lipopolysaccharide core biosynthesis glycosyltransferase WaaE OS=Klebsiella pneumoniae OX=573 GN=waaE PE=3 SV=1
Q54435	5.89e-06	3	88	7	87	Lipopolysaccharide core biosynthesis glycosyltransferase KdtX OS=Serratia marcescens OX=615 GN=kdtX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998800	0.001188	0.000026	0.000002	0.000001	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002369_00221.