CAZyme Information: MGYG000002369_00900

Basic Information

• Species: Clostridioides difficile
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Clostridioides; Clostridioides difficile
• CAZyme ID: MGYG000002369_00900
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000002369_1|CGC7	37358.06	9.9436

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002369	4190038	Isolate	United States	North America

• Gene Location: Start: 989283; End: 990257 Strand: +

Full Sequence      

MARKLIKNLGKSKSVKRVKLLFKKIFITVFIVASIVAIFNITKYFEELYKVRDLKSTKIE
YYMDVADEAGDGKVQLSWKALLAIDMVIHDEDLSNIKKKDTLDIGEKFIVEDKNDKGEKV
YKVKKFNKVLSELKFDSSQKSRARKYMKDLEYTYLGNKQLDSSDEKIKFIKKLEDSAIRE
YIDYGILPSVTIGQAILESGWGNSKLTKQSNNLFGIKADKAWKGKSVEISTSEHYNEKIV
ASFRSYNSLQDSVKDHSLFLINNKRYRKHGLFEAKDYISQAQALENAGYSTAEDKKGNRI
YAELLIDIIRSYNLQLIDNKVETK

Enzyme Prediction     

No EC number prediction in MGYG000002369_00900.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	176	314	6.1e-37	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.62e-49	162	319	39	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	1.40e-30	185	311	171	296	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	2.82e-27	168	316	10	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	9.37e-26	175	256	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
NF038016	sporang_Gsm	2.75e-23	169	314	163	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGS39496.1	5.18e-224	1	324	1	324
AVB36696.1	5.18e-224	1	324	1	324
QPK95697.1	5.18e-224	1	324	1	324
AXB60139.1	5.18e-224	1	324	1	324
AYC96636.1	5.18e-224	1	324	1	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	2.72e-16	160	291	1	133	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.79e-16	160	291	1	133	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	2.09e-12	185	291	20	131	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	2.50e-12	185	291	21	132	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
5T1Q_A	4.42e-12	160	320	55	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	3.33e-23	157	318	39	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	1.16e-16	164	291	158	290	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	9.75e-16	164	312	159	312	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P15931	1.31e-14	161	291	142	282	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	3.20e-14	185	291	168	279	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000019	0.000017	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	42