CAZyme Information: MGYG000002369_02097

Basic Information

• Species: Clostridioides difficile
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Clostridioides; Clostridioides difficile
• CAZyme ID: MGYG000002369_02097
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297		34316.35	9.7499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002369	4190038	Isolate	United States	North America

• Gene Location: Start: 2271584; End: 2272477 Strand: -

Full Sequence      

MKNKKFIVIILIISILIGVLVKEYSSREIKKDDINVSKYIKYADLASKNNAQVNWKYVAS
IVAVLNKNNLKNVKDSQIQEVSDLFVKNFSKNNKINKLSDILDELEFSNRQKRLVDNYID
NLKDYGIKPERLKSDTKYMKFIAEIKTEAIQNYKDYKILPSITIAQAIIESSWGKSTLAK
QYNNLFGIKADAYWKGKSVTLETKEHLDTIIDDKFRIYDDKNESIKDHAKFLATNKRYKN
NGVFDAKTYIYQAKALEKAGYSTAKDENGNSIYAARLIELIQQYNLQLIDSEIQSEV

Enzyme Prediction     

No EC number prediction in MGYG000002369_02097.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	147	286	7e-37	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.56e-48	139	290	44	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	1.58e-25	138	288	8	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	2.72e-23	141	286	163	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
PRK05684	flgJ	2.72e-23	141	283	155	296	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	2.16e-22	149	228	4	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVB41582.1	1.20e-204	1	297	1	297
QGS38332.1	1.20e-204	1	297	1	297
AXB68767.1	1.20e-204	1	297	1	297
AYD10323.1	1.20e-204	1	297	1	297
AYD07270.1	1.20e-204	1	297	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	4.71e-18	141	290	33	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	1.18e-12	141	283	6	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.58e-12	141	283	6	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	1.23e-09	141	292	63	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.29e-19	141	290	51	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	1.47e-13	141	290	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	2.66e-13	158	290	82	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	6.50e-13	158	290	82	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
Q9X9J3	9.97e-12	141	283	163	304	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.736984	0.252389	0.007987	0.000459	0.000349	0.001836

TMHMM  Annotations     

start	end
7	21