CAZyme Information: MGYG000002369_02681

Basic Information

• Species: Clostridioides difficile
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Clostridioides; Clostridioides difficile
• CAZyme ID: MGYG000002369_02681
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
240	MGYG000002369_1|CGC22	28763.12	6.9361

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002369	4190038	Isolate	United States	North America

• Gene Location: Start: 2956262; End: 2956984 Strand: -

Full Sequence      

MIPKKIHYVWFGGPKGNIENICINSWKEKLPEYEIVEWNEKNFDIEKEIKGNKFLEECYK
RKLWAFISDYTRIKVLYEQGGVYMDTDMQILKDITPLLENNRLICGYEDDREYINGAIIG
VEKGHPFLKDLLEYYEKEVLTSSLFTIPKIMTHLMEKNYKKIDPNNYEEGIRVYDKEYFY
PFGFKEDFTPECITENTFGIHWWGKSWAKKRNYFLESKHLTGVNKIWKCCKIFASNTLRS

Enzyme Prediction     

No EC number prediction in MGYG000002369_02681.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	22	100	4.3e-23	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	9.35e-34	1	229	81	304	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.89e-13	19	103	4	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.38e-06	1	138	45	195	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.001	4	42	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.009	41	88	146	194	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXU47385.1	2.00e-188	1	240	1	240
AUA30090.1	2.00e-188	1	240	1	240
AVB42155.1	2.00e-188	1	240	1	240
AXU61913.1	2.00e-188	1	240	1	240
AXU80359.1	2.00e-188	1	240	1	240

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q67BJ4	3.31e-09	67	205	180	325	Lactosylceramide 4-alpha-galactosyltransferase OS=Mus musculus OX=10090 GN=A4galt PE=2 SV=1
Q9N289	1.21e-08	63	205	35	184	Lactosylceramide 4-alpha-galactosyltransferase (Fragment) OS=Pongo pygmaeus OX=9600 GN=A4GALT PE=3 SV=1
Q9N291	1.46e-08	63	205	170	319	Lactosylceramide 4-alpha-galactosyltransferase OS=Pan troglodytes OX=9598 GN=A4GALT PE=3 SV=1
Q9NPC4	1.46e-08	63	205	170	319	Lactosylceramide 4-alpha-galactosyltransferase OS=Homo sapiens OX=9606 GN=A4GALT PE=1 SV=1
Q9JI93	1.48e-08	63	205	177	326	Lactosylceramide 4-alpha-galactosyltransferase OS=Rattus norvegicus OX=10116 GN=A4galt PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002369_02681.