CAZyme Information: MGYG000002370_01147

Basic Information

• Species: Clostridioides difficile_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Clostridioides; Clostridioides difficile_A
• CAZyme ID: MGYG000002370_01147
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324	MGYG000002370_28|CGC2	37538.16	9.8045

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002370	4277521	Isolate	France	Europe

• Gene Location: Start: 113207; End: 114181 Strand: +

Full Sequence      

MARKTIKNLGRNKSVRRIKLLLKKIFITVCIIASIIAVFNITKYFEELYKVRDIESTKIE
YYMDVADEAGDSKVQLSWKELLAIDMVIHDEDLSNIKKKDTLNIGKKFITEDKNDKGEDV
YKVKKFTKVLSELKFDSSQKSRAKKYMKDLEYTYLGNKELNNSDEKIKFIKKLEDSAIRE
YIDYGILPSITIGQAILESGWGNSKLTKQSNNLFGIKADKAWKGKKVEISTSEHYNEKIV
ANFRSYNSLQDSVRDHSLFLVDNKRYRKHGLFEAKDYISQAQALENAGYSTAEDKKGNRI
YAELLIEVIRSYNLQLIDNKVETK

Enzyme Prediction     

No EC number prediction in MGYG000002370_01147.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	176	314	1.2e-36	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	3.74e-49	162	319	39	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	5.74e-31	185	311	171	296	flagellar assembly peptidoglycan hydrolase FlgJ.
pfam01832	Glucosaminidase	2.72e-26	175	256	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	5.92e-26	168	316	10	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK12713	flgJ	7.92e-22	164	309	179	323	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXU63721.1	5.19e-208	1	324	1	324
AXU45589.1	5.19e-208	1	324	1	324
AWH80492.1	5.19e-208	1	324	1	324
AWH76725.1	5.19e-208	1	324	1	324
AXB63823.1	7.38e-208	1	324	1	324

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN5_A	1.36e-15	185	291	22	133	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	1.88e-15	185	291	22	133	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	2.86e-12	185	315	20	149	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.42e-12	185	315	21	150	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.24e-11	185	315	21	150	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.69e-22	157	318	39	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	1.30e-17	164	308	158	301	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	3.33e-15	164	291	159	291	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
P58231	8.00e-14	185	291	168	279	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
P75942	8.00e-14	185	291	168	279	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999996	0.000023	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
20	42