CAZyme Information: MGYG000002370_01738

Basic Information

• Species: Clostridioides difficile_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Clostridioides; Clostridioides difficile_A
• CAZyme ID: MGYG000002370_01738
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000002370_36|CGC1	52756.84	7.5316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002370	4277521	Isolate	France	Europe

• Gene Location: Start: 6725; End: 8170 Strand: +

Full Sequence      

MKSKKLLSLGIAMSMFVAGCPISANALDKIDKIQGADKYETAGLIADRENYTTAILVNAD
STMADGLSASGLAGATNAPILLTKKNNIPSATMKRVEKANKVYIIGGESSIDKATENVLK
GKNIEVKRLQGSDRIKTSYNVAKEIGAINKVSKVILTNAFKGEPDAMSIASVAVRDKAPI
VLTDGKSVPFNTTGTESYIIGGTSSMSDNLVNDTNSTRLGGVDRYDTNKKIINKFYNEAK
EFYIASGTDLVYALAGSTIAKNTPTVLVDDNSNKTVLKSATKITAIGNLNDSILQQCLNV
TKNIGNSDTGKQYTVEDAANAVKKLLGVDKLYYNENYPEDEDLIFLLDTSFEYSGKQFYV
FGYVTENSEGDVRYCVEKNDMSKVYTYNVSGIMEVCNPADYENRKMITEDKAKELALAEC
ARKHKVSVNLLRVNTAYIDDINNIKVYAVRIDSKPQPKQTYGWYFIDVYSGYAYKDIWNN
I

Enzyme Prediction     

No EC number prediction in MGYG000002370_01738.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033435	S-layer_Clost	5.99e-23	65	276	430	675	S-layer protein SlpA. In Clostridiodes difficile, the S-layer protein precursor, SlpA, is one member of a large paralogous family of protein that share several cell wall-binding repeats. SlpA is cleaved into a larger and smaller protein. The S-layer protein itself is important to adhesion, and portions of it are highly variable, and then N-terminal and C-terminal are well-conserved.
pfam04122	CW_binding_2	1.13e-18	33	114	2	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
pfam04122	CW_binding_2	9.06e-15	128	209	1	80	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
pfam04122	CW_binding_2	9.08e-12	218	287	1	72	Putative cell wall binding repeat 2. This repeat is found in multiple tandem copies in proteins including amidase enhancers and adhesins.
COG2247	LytB	6.01e-10	41	160	17	141	Putative cell wall-binding domain [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY46700.1	4.87e-106	4	309	5	308
AVD38579.1	4.87e-106	4	309	5	308
AVD42108.1	4.87e-106	4	309	5	308
QQY76565.1	4.87e-106	4	309	5	308
AFV69567.1	4.87e-106	4	309	5	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5J72_A	6.60e-31	30	268	132	393	ChainA, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630],5J72_B Chain B, Putative N-acetylmuramoyl-L-alanine amidase,autolysin cwp6 [Clostridioides difficile 630]
5J6Q_A	9.68e-31	29	287	285	576	ChainA, Cell wall binding protein cwp8 [Clostridioides difficile 630]
7ACZ_B	1.55e-21	25	270	35	339	ChainB, SLPH (HMW SLP) [Clostridioides difficile R20291],7ACZ_D Chain D, SLPH (HMW SLP) [Clostridioides difficile R20291]
7ACX_B	1.85e-21	25	260	35	315	ChainB, S-layer protein [Clostridioides difficile],7ACX_D Chain D, S-layer protein [Clostridioides difficile]
7ACY_B	1.85e-21	25	260	35	315	ChainB, S-layer protein [Clostridioides difficile 630],7ACY_D Chain D, S-layer protein [Clostridioides difficile 630],7QGQ_B Chain B, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_D Chain D, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_J Chain J, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_K Chain K, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_L Chain L, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_M Chain M, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_N Chain N, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_T Chain T, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_U Chain U, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_V Chain V, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_W Chain W, Precursor of the S-layer proteins [Clostridioides difficile 630],7QGQ_X Chain X, Precursor of the S-layer proteins [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02113	7.75e-25	31	282	63	318	Amidase enhancer OS=Bacillus subtilis (strain 168) OX=224308 GN=lytB PE=1 SV=1
Q02114	1.69e-23	23	260	21	265	N-acetylmuramoyl-L-alanine amidase LytC OS=Bacillus subtilis (strain 168) OX=224308 GN=lytC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000358	0.528191	0.470840	0.000219	0.000212	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002370_01738.