CAZyme Information: MGYG000002370_02345

Basic Information

• Species: Clostridioides difficile_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Clostridioides; Clostridioides difficile_A
• CAZyme ID: MGYG000002370_02345
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000002370_39|CGC1	34355.23	9.0518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002370	4277521	Isolate	France	Europe

• Gene Location: Start: 140103; End: 140996 Strand: -

Full Sequence      

MKNKKFIVIILIISVLIGVGVKEYFTRDINKEDIEVSKYIKYSDLASKNNVQVNWKYVAS
IVAVLNKNNLKEVKDSQIKEVSDLFVKNFSENNKINKLSNVLDELEFSNKQKRLVDNYID
ELKDYGIKPERLKSDTQYMKFINEIKEEAIQNYEDYKILPSITIAQAIIESSWGKSTLAK
QHNNLFGIKADASWKGKSVTLETKEHLDTIIDDKFRIYDDKNESIKDHAKFLATNKRYKA
NGVFDAKTYIYQAKALEKAGYSTAKDENGKSIYADRLIEIIQQYNLQLIDSEIQSNM

Enzyme Prediction     

No EC number prediction in MGYG000002370_02345.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	147	286	8.2e-38	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	2.18e-52	128	290	34	188	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	7.63e-27	160	283	174	296	flagellar assembly peptidoglycan hydrolase FlgJ.
smart00047	LYZ2	7.05e-26	138	288	8	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
NF038016	sporang_Gsm	1.52e-25	141	286	163	308	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	1.59e-22	146	228	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXU31987.1	2.32e-186	1	297	1	297
AXU28190.1	2.32e-186	1	297	1	297
AXU35775.1	2.32e-186	1	297	1	297
QOX86824.1	1.90e-185	1	297	1	297
AXU53978.1	1.90e-185	1	297	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	6.52e-18	136	290	28	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	4.79e-14	162	283	27	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	6.52e-14	162	283	27	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	6.44e-11	140	292	62	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.72e-22	128	290	34	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	2.95e-14	141	283	163	304	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9CIT4	6.53e-13	141	290	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	1.58e-12	141	290	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P15931	2.31e-12	162	283	176	296	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.708491	0.276448	0.011838	0.000608	0.000435	0.002182

TMHMM  Annotations     

start	end
7	26