CAZyme Information: MGYG000002370_03394

Basic Information

• Species: Clostridioides difficile_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Clostridioides; Clostridioides difficile_A
• CAZyme ID: MGYG000002370_03394
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MGYG000002370_47|CGC5	55697.83	4.7351

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002370	4277521	Isolate	France	Europe

• Gene Location: Start: 226679; End: 228121 Strand: -

Full Sequence      

MNFEDTFFWGGSIAAHQCEGAWDVDNKGAAIMDFVTKGSYETPRVITDKIEEELDYPSHN
GIDFYNRYKEDIALFKEIGFSALRISIDWSRIFPNGDDNNPNELGLKYYEDLIDTLIENN
IEPIVTLYHFELPINLVHKYGSWNNRKLIDLYLKYSETIMRKFDNKVKYWVTFNEMNHID
PQTEHSDIFTYMIAGIKYSEMQDKVQTLANVGYNMTLASVKVTKLAREINPNNKVGCVFG
LNPIYPYNCNPSNVLNAFLDNDCDYYQIDAMCNGKFPQYKLREYEKNNINIEVTNEDKEA
FKEGRLDFIGLNYYFSSVSIPKESLSSDKSLFGGVQNPYLEQSKWGWAIDPIGLRFTLNY
IYRKYQLPILITENGLGAYDRVEKDGTINDDYRIEYLSKHLSQMKSAIKEDNVECFGYLM
WAPIDLVSATTGQMSKRYGFIYVDLDDEGKGSFKRCKKKSFDWYKEVIKSNGDNLSSLDI

Enzyme Prediction     

No EC number prediction in MGYG000002370_03394.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	472	4.6e-135	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	475	2	476	6-phospho-beta-glucosidase; Reviewed
COG2723	BglB	0.0	1	473	2	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK15014	PRK15014	1.35e-176	7	475	10	477	6-phospho-beta-glucosidase BglA; Provisional
PRK09593	arb	6.29e-173	1	476	4	478	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	1.21e-165	3	476	4	474	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXU51324.1	0.0	1	480	1	481
AXU32943.1	0.0	1	480	1	481
AXU36731.1	0.0	1	480	1	481
AXU29155.1	0.0	1	480	1	481
AWH82571.1	0.0	1	480	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	4.83e-169	1	475	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	3.67e-156	5	475	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.04e-155	5	475	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
6WGD_A	3.33e-154	2	475	7	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
3PN8_A	3.14e-152	5	475	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	2.65e-168	1	475	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P42973	1.05e-157	2	475	3	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P40740	1.72e-156	2	475	7	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	3.93e-138	3	475	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	5.38e-138	1	475	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002370_03394.