CAZyme Information: MGYG000002372_00222

Basic Information

• Species: Clostridium_P perfringens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P perfringens
• CAZyme ID: MGYG000002372_00222
• CAZy Family: GH84
• CAZyme Description: Hyaluronoglucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1628	MGYG000002372_1|CGC4	182491.12	4.2352

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002372	3343822	Isolate	South Korea	Asia

• Gene Location: Start: 252335; End: 257221 Strand: +

Full Sequence      

MNKNIRKIITSTVLAAMTISVLPSNLVVFATDGITENFYEIYPKPQEISYSGGEFQISDE
INIVYDDGIDTYTKKRVDEVLEASNLEATVSNEIVPGKTNFLVGINESGGVVDNYFNKNI
PHDESFFDEKMDANIVSVKDGVIGVIGEDTDSAFYGVTTLKHVFNQLEEGNKIQSFRADD
YAEVAHRGFIEGYYGNPWSNEDRAELMKFGGDYKLNQYVFAPKDDPYHNSKWRDLYPEEK
LSEIKKLAQVGNETKNRYVYALHPFMNNPVRFDTEENYQNDLGVIKAKFTQLLENDVRQF
AILADDASAPAQGASMYVKLLTDLTRWLEEQQSTYPDLKTDLMFCPSDYYGNGSSAQLKE
LNKAEDNVSIVMTGGRIWGEVDENFANNFMNNISTEGHPGRAPFFWINWPCSDNSKQHLI
MGGNDTFLHPGVDPSKIDGIVLNPMQQAEANKSALFAIADYAWNIWDNKEEADENWNDSF
KYMDHGTAEETNSSLALREISKHMINQNMDGRVRPLQESVELAPKLEAFKQKYDSGASIK
EDALELIEEFTNLQKAAEYYKNNPGNERTRDQIIYWLNCWEDTMDAAIGYLKSAIAIEEG
DDEAAWANYSEAQSAFEKSKTYGFHYVDHTEYAEVGVQHIVPFIKSIGQNLSVVIGSIVD
PNRIIATYISNRQDAPTGNPDNIFDNNASTELVYKNPNRIDVGTYVGVKYSNPITLNNVE
FLMGANSNPNDTMQKAKIQYTVDGREWIDLEEGVEYTMPGAIKVENLDLKVRGVRLIATE
ARENTWLGVRDINVNKKEDSNSGVEFNPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTL
NGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYD
KTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVSDELESAGNKENVYTN
TELDLLSLAKEDVTKLIPTDDISLNHGEYIGVKLNRIKDLSNINLEISNDTGLKLQSSMN
GVEWTEITDKNTLEDGRYVRLINTSNEAVNFNLTKFEVNSNEVYEPSLVDAYVGDDGAKK
AVDGDLKTRVKFLGAPSTGDTIVYDLGQEILVDNLKYVVLDTEVDHVRDGKIQLSLDGET
WTDAINIGDGVENGVDDMFSTPLKNGYKHGNQSGGIVPIDSAYVEGDNLNQKARYVRILF
TAPYRHRWTVINELMINNGEYISTVNDPTYISNPIEERGFAPSNLRDGNLTTSYKPNTNN
GEISEGSITYRLSEKTDVRKVTIVQSGSSISNAKVMARVGDGSENVTDQWVQLGTLSNSL
NEFINRDYNNIYEIKIEWTDVAPNIYEIITLNQEFEFPVNDSLKAKYDELINLSGDEYTL
SSFETLKEALNEAKSILDDSNSSQKKIDKALENLNKAEERLALRATDFEDFNKVLTLGNS
LVEEEYTAESWALFSEVLEVANEANKNKADYTQDQINQIVIDLDASIKALVKETPEVDKT
NLGELINQGKSLLEESVEGFNVGEYHKGAKDGLAVEINKAEEVFNKEDSTEEEINSSKES
LEGAIARFNSLLIEESTGDFNGNGKIDIGDLAMVSKNIGSTTNTSLDLNKDGSIDEYEIS
FINHRILN

Enzyme Prediction     

EC	3.2.1.35	3.2.1.52

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	187	491	4e-104	0.976271186440678
CBM32	816	941	8.6e-18	0.8951612903225806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.17e-120	187	500	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
cd00057	FA58C	5.70e-27	800	934	1	134	Substituted updates: Jan 31, 2002
pfam00754	F5_F8_type_C	5.12e-17	813	941	5	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam02838	Glyco_hydro_20b	4.94e-16	39	180	2	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
cd14254	Dockerin_II	4.14e-10	1578	1627	1	54	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOY52617.1	0.0	1	1628	1	1628
QQA12181.1	0.0	1	1628	1	1628
ASY50288.1	0.0	1	1628	1	1628
QUD73312.1	0.0	1	1628	1	1628
SQG37474.1	0.0	1	1628	1	1628

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV4_A	0.0	30	660	23	653	Structureof CpGH84A [Clostridium perfringens ATCC 13124],6PV4_B Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_C Structure of CpGH84A [Clostridium perfringens ATCC 13124],6PV4_D Structure of CpGH84A [Clostridium perfringens ATCC 13124]
6PWI_A	1.23e-140	39	649	34	622	Structureof CpGH84D [Clostridium perfringens ATCC 13124],6PWI_B Structure of CpGH84D [Clostridium perfringens ATCC 13124]
2W1Q_A	2.85e-108	807	975	24	192	Uniqueligand binding specificity for a family 32 Carbohydrate- Binding Module from the Mu toxin produced by Clostridium perfringens [Clostridium perfringens],2W1Q_B Unique ligand binding specificity for a family 32 Carbohydrate- Binding Module from the Mu toxin produced by Clostridium perfringens [Clostridium perfringens],2W1U_A A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium perfringens, in complex with beta-D-glcNAc-beta(1,3) galNAc [Clostridium perfringens],2W1U_B A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium perfringens, in complex with beta-D-glcNAc-beta(1,3) galNAc [Clostridium perfringens],2W1U_C A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium perfringens, in complex with beta-D-glcNAc-beta(1,3) galNAc [Clostridium perfringens],2W1U_D A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium perfringens, in complex with beta-D-glcNAc-beta(1,3) galNAc [Clostridium perfringens],2WDB_A A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium perfringens, in complex with beta-D-glcNAc-beta(1,2) mannose [Clostridium perfringens],2WDB_B A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium perfringens, in complex with beta-D-glcNAc-beta(1,2) mannose [Clostridium perfringens],2WDB_C A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium perfringens, in complex with beta-D-glcNAc-beta(1,2) mannose [Clostridium perfringens],2WDB_D A family 32 carbohydrate-binding module, from the Mu toxin produced by Clostridium perfringens, in complex with beta-D-glcNAc-beta(1,2) mannose [Clostridium perfringens]
2W1S_A	1.91e-107	807	975	24	192	Uniqueligand binding specificity of a family 32 Carbohydrate-Binding Module from the Mu toxin produced by Clostridium perfringens [Clostridium perfringens],2W1S_B Unique ligand binding specificity of a family 32 Carbohydrate-Binding Module from the Mu toxin produced by Clostridium perfringens [Clostridium perfringens]
4TXW_A	1.23e-106	1063	1229	7	173	Crystalstructure of CBM32-4 from the Clostridium perfringens NagH [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26831	0.0	1	1628	1	1628	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
Q89ZI2	9.04e-55	82	592	53	535	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	2.02e-51	43	616	48	601	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	8.23e-51	43	824	48	795	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
O60502	8.85e-22	188	461	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.998915	0.000195	0.000207	0.000177	0.000159

TMHMM  Annotations     

start	end
13	35