CAZyme Information: MGYG000002372_00366

Basic Information

• Species: Clostridium_P perfringens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P perfringens
• CAZyme ID: MGYG000002372_00366
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	MGYG000002372_1|CGC6	74058.94	5.0096

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002372	3343822	Isolate	South Korea	Asia

• Gene Location: Start: 415741; End: 417630 Strand: +

Full Sequence      

MKVLGNYIQRNFHYDGKSFYTTSFLNPILNEEILVHTQNEFIIYFVDGEILPSSEMNVEI
KKQSEQLLVVNFSKDNLSVEVNYFVENKVINKKLTVFNCCKRINYIDCDTFEFEDTNNIY
YPKKQNNIKEMGNFNGYYVELGQPIYAKSLFMGMEFPMGENRIQERKYFSRYYYGKSVEK
RLDIHSAIIGAAPEKSKEKIQASFFEYIKAISLPATFRKQYNSWYDHMLNITNDSIIKSF
LEINRGFKNYGITLDAFVVDDGWANYESVWEFNDKFPNELKDISECVKNLGSTLGLWIGP
RGGYNGTQVTMSDWLEKNKDLNIGSKNKISNDVNVGDFNYLRKMKEKMLEYQSKYDISYW
KIDGMLLKPDTEDESGPYGMHTMTAVYEFMISLFNELREERGEKSFWINLTSYVNPSPWF
LKWVNSLWIQTSQDVGFTPNGGNDIQKMITYRDSQYYEFLIERDIQLPLCSLYNHEPIYA
ESASMWYLDHQIYCSIEEFKEYLMFIATRGNAFWEFYYSYSMFDDERWEVNAQAIKWIEE
NYPILKNSTFFGTKPSLMGVYGYYCQSDSGSKSIISFRNPSDEIKSYKLENIEPKKYDVV
LGNKNYKVFEDGSVEVKLNPKEIIILKSK

Enzyme Prediction     

No EC number prediction in MGYG000002372_00366.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.82e-13	221	403	6	191	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	1.00e-05	220	300	4	80	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	7.60e-05	200	300	19	126	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	3.26e-04	203	300	273	377	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOY52751.1	0.0	1	629	1	629
SQG37607.1	0.0	1	629	1	629
AAM55479.1	0.0	1	629	1	629
BAB80031.1	0.0	1	629	1	629
ALG47711.1	0.0	1	629	1	629

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002372_00366.