CAZyme Information: MGYG000002372_00637

Basic Information

• Species: Clostridium_P perfringens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P perfringens
• CAZyme ID: MGYG000002372_00637
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
767	MGYG000002372_1|CGC13	87273.17	4.847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002372	3343822	Isolate	South Korea	Asia

• Gene Location: Start: 742392; End: 744695 Strand: +

Full Sequence      

MIKKFIIATVITLSVTSINVIALENVNNNSDENKYSTLVGETYEIVKKPNMFFLIPNDNV
ESYKDENGIKREEFKKDKEGQESINRLVTKTKSKYEIALAHENGKYTFLDSANTKEEAEN
KVKNLSGKYNTFAAMPVVLNDSGQVAYSEKSMGRLVKYKNGSPAGYGEITNIYANPNLTN
DFTYINHGYVDDVPIIEDRGNVAKIEVGGYEGWVNKDTSSGNYDLVIVPLNQVKNPSYYI
VRDGELIHYISSDLTNYSEGGYEVIIGPAPNFLSENVKYYSYDNKYFYKDLSTLIGDLQN
DNHNNSVNANNPFYPYYMNLPFRSKTTFTAEELNNFIDKKTKSYSKLRGTGQAFIDAQNK
YGANALLLLGLAANESAWGTSQIAQQKNNLFGINAIDSSPGASANSFETVEGCINDFAKY
YISRGYSDPEDWRYFGGYLGNKGSGANVKYASDPFWGEKAGQNAYIADYWASGKGISGLK
DYNYYQLGIYTGASSVTNKDNEKLYDVGDLYTERVEKIGATTILTSKEKINHNGKDCYEI
NPVRTTPVISNGSAVAFKGPYDWNDKGFVDASKVKLINEGKYSENVIGKWVMNEGIWYYY
LGEKYAIGLKFIDGYWYYFNQNGEMQIGWQKIDGNWYYFRPDGNMKIGWEEINGYWYYFN
EDGVMQTGWQEIGGKWYYFRPDGNMRIGWEEINGYWYYFNGDGVMQTGWQELGGKWYYFR
PDGNMKIGWEKINGCWYYFNGDGVMLTGTQKIDGVIYNFKDNGMLIE

Enzyme Prediction     

No EC number prediction in MGYG000002372_00637.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	351	460	3.7e-21	0.9140625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033930	pneumo_PspA	8.33e-52	590	754	445	609	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	2.07e-49	608	763	444	599	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	3.08e-47	590	745	465	621	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033838	PspC_subgroup_1	1.21e-46	590	745	488	644	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.
NF033838	PspC_subgroup_1	3.24e-46	608	754	487	632	pneumococcal surface protein PspC, choline-binding form. The pneumococcal surface protein PspC, as described in Streptococcus pneumoniae, is a repetitive and highly variable protein, recognized by a conserved N-terminal domain and also by genomic location. This form, subgroup 1, has variable numbers of a choline-binding repeat in the C-terminal region, and is also known as choline-binding protein A. The other form, subgroup 2, is anchored covalently after cleavage by sortase at a C-terminal LPXTG site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOY53018.1	0.0	1	626	1	626
AWS25220.1	0.0	1	626	1	626
ASY50729.1	0.0	1	626	1	626
ALG48000.1	0.0	1	626	1	626
QQA11780.1	0.0	1	623	1	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2W_A	2.77e-23	326	459	147	274	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P59206	1.20e-21	141	459	410	686	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1
P59205	3.29e-21	164	459	386	642	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001241	0.997734	0.000367	0.000219	0.000202	0.000203

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002372_00637.