CAZyme Information: MGYG000002372_01631

Basic Information

• Species: Clostridium_P perfringens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P perfringens
• CAZyme ID: MGYG000002372_01631
• CAZy Family: GH123
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	MGYG000002372_1|CGC25	67915.46	5.3271

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002372	3343822	Isolate	South Korea	Asia

• Gene Location: Start: 1791323; End: 1793086 Strand: +

Full Sequence      

MKKDTILGASICSTDFHYLQKDYDEIKKLNLNTWNEVAWIGDELNSKIVMWTNSSPVNNV
TLSSSDFINENGDLISSNNIKISWLKETLANIGRSNPSAPLEPFPDIIYNSGSLNIEKNK
IASAWINIKIPRNAKPGIYNGSIEVTADELEKAYTFDYSFEVLNLVQPLPRETNTQIEFW
QHPYTIARYYKISKEDLFTEKHFKYLRDNLKEYRNMGGRGVIATIVHEAWNHQSYDSDPS
MIKWRKNSYGTFEFDYSHFDKWIQLNIDLGILDPEKGFGQIKCYSIVPWNNRIQYFNEAT
NKEEAINPNPGSDLWINIWTQFLTSFMSHLEEKGWFNITYISMDERSMDDLKACVDLIES
ITNKLGEHFKISSAMDYESGNDYSFLDRIDDISIGLSHINHNSNDMKNMAKHRQELGLLT
TIYTCTGDYPSSFTISDPIEGAFTIWYSLYQNTNGFLRWSWDGWVENPLENVSYKYWEPG
DPFLIYPAEKDSIGKTFYSTPRLEKLKEGIRDINKAKYLMEKAPNLKNSIENLIYSLKRP
NKGENSYGSAVAASKEDRDLTISEAKRMKKGINNFARKFISLTMETL

Enzyme Prediction     

EC	3.2.1.53	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH123	5	573	7.5e-208	0.9925650557620818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13320	DUF4091	7.63e-21	452	520	1	66	Domain of unknown function (DUF4091). This presumed domain is functionally uncharacterized. This domain family is found in bacteria, archaea and eukaryotes, and is approximately 70 amino acids in length. There is a single completely conserved residue G that may be functionally important.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOY54035.1	0.0	1	587	1	587
ATD48594.1	0.0	1	587	1	587
SQG39184.1	0.0	1	587	1	587
ASY51538.1	0.0	1	587	1	587
AWS26050.1	0.0	1	587	1	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FQE_A	0.0	1	587	24	610	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQE_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQF_B The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FR0_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5FQG_A	0.0	1	587	24	610	Thedetails of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens],5FQH_A The details of glycolipid glycan hydrolysis by the structural analysis of a family 123 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens]
5L7V_A	3.90e-92	13	538	32	537	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7V_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]
5L7R_A	5.77e-92	13	538	47	552	ChainA, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7R_B Chain B, glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_A Chain A, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482],5L7U_B Chain B, Glycoside hydrolase [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002372_01631.