CAZyme Information: MGYG000002372_01887

Basic Information

• Species: Clostridium_P perfringens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P perfringens
• CAZyme ID: MGYG000002372_01887
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1127	MGYG000002372_1|CGC29	127440.39	4.4126

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002372	3343822	Isolate	South Korea	Asia

• Gene Location: Start: 2081772; End: 2085155 Strand: -

Full Sequence      

MNKKKIKKLIKSALATTCAVSVITTTSVTAFASNSGENSKEEESNKRVEAEVYPVPQSLE
HSSIEGMTLEGEVNIVYHGEQEAATSKRLERTLNENNIAFKVSENVEEGKANIIVSSEGD
HCDVCSEGKEENSDVLTHKEGYVLKTSNDINEKGNISIIGSDKDGAYYGVLTLSQILEQS
NEDNKFAEVVVTDYPEIEFRGFIEGFYGVPWSHEDRMNLMKDTSEYKMNTYIYAPKDDPY
HRLSWKELYPEQEAKQIAELAKAGAENNFNFCWTIHPGATLQFTDEDFDALINKFEQLYS
LGVRQFGVLFDDTDDWRNGQKQAEWINKIDTEFVKAKGDVAPMIVISARYNSAWGPNMDR
YFKPFMQTLHDDIQVMWTGHATMSNVSKEVFEWPKVQTGVDKDVAVWWNYPVNDYCDSRI
LMAPLHNLNQDLDNVSGFFSNPMNQAEASKVALYSIADYTWNTDAFDYMKSWETSIEKFV
PEVKEEFMRFASNTCYLKDDGGASGPFEYDESWYLSEKIDALKESMKNGQSAVKPAKDLL
EEFKLIVSDYESITSKVTNKNLLDEIEQHLNAYKALGEAGIAAMEAIIASEEGNLELWMN
SNSLAQEKLDLMETFKIESLESDGPKEYVVSVGTKLLKPLVKESMDYAKEKMEEVVLPKY
DPEINTSLTNLKDVEVNFEDGIYSLRDLGEVTLNNGDYVGISLPKATKLRGINLLANNYD
NIEIQYSINGLDWVTAKASTNENVLETLDVVDATFIRIINIGENSKNINLEKLEVLPVYK
AEPTITENIGTHENYTIDKALDGNMDTKYWSNKPSDSGHNIQIDLGNVMPLYDINTYFGA
NDFMRNSEYMISEDGVNWTSLGELAYNSQDGKMVASANAEGKMARYIKIQSNGHNYGCWV
EIYEIEFNKTAPEFDESAVNLASGTLEGNFNAFYDEDLSTAYEAKSVKDGDSLIYKMSRV
TNISELEILQDKNRISEAKVSVKDLGGNWTEIGHLNAQINKLKVDNNITEVKFEFEGSKP
APKIYEIIARERKEQEEIVVSPVKEFKATTINKKNVTVSWEEPENTFGLESYILYKDGKK
VSEISSDETSYTFKGLNRHTIYNFKIAAKYSNGEISKKESLTLRTAR

Enzyme Prediction     

No EC number prediction in MGYG000002372_01887.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	200	491	3.3e-105	0.9932203389830508
CBM32	789	905	3.4e-16	0.8951612903225806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	3.59e-141	200	490	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	6.69e-16	51	193	3	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	3.30e-14	792	905	9	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00063	FN3	8.65e-11	1041	1125	2	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	2.71e-09	1041	1114	2	82	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOY54289.1	0.0	1	1127	1	1127
BAB81229.1	0.0	1	1127	1	1127
AWS26335.1	0.0	1	1127	1	1127
ASY51816.1	0.0	1	1127	1	1127
AQW24088.1	0.0	1	1127	1	1127

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV5_A	2.43e-107	52	587	42	575	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
5OXD_A	5.30e-100	43	610	9	567	Complexof a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]
2J62_A	5.91e-100	43	610	7	565	Structureof a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2J62_B Structure of a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2WB5_A GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens],2WB5_B GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens]
2XPK_A	2.19e-99	43	610	7	565	Cell-penetrant,nanomolar O-GlcNAcase inhibitors selective against lysosomal hexosaminidases [Clostridium perfringens],2XPK_B Cell-penetrant, nanomolar O-GlcNAcase inhibitors selective against lysosomal hexosaminidases [Clostridium perfringens]
2YDQ_A	2.73e-99	43	610	9	567	CpOGAD298N in complex with hOGA-derived O-GlcNAc peptide [Clostridium perfringens],2YDR_A CpOGA D298N in complex with p53-derived O-GlcNAc peptide [Clostridium perfringens],2YDS_A CpOGA D298N in complex with TAB1-derived O-GlcNAc peptide [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TR53	2.17e-139	1	1127	1	1001	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	8.21e-139	1	1127	1	1001	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q89ZI2	2.33e-96	135	641	95	586	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
P26831	5.36e-76	51	996	40	1031	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	3.91e-30	201	461	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000622	0.998370	0.000340	0.000262	0.000216	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002372_01887.