CAZyme Information: MGYG000002372_02428

Basic Information

• Species: Clostridium_P perfringens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P perfringens
• CAZyme ID: MGYG000002372_02428
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357	MGYG000002372_1|CGC35	39713.48	9.8741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002372	3343822	Isolate	South Korea	Asia

• Gene Location: Start: 2660812; End: 2661885 Strand: -

Full Sequence      

MKKYKIIMTGGGSAGHVTPNLALVPKLKELGFEIKYIGSKNGIEKEIITKENIPYYSISS
GKLRRYFDIKNFTDPFKVLKGVMDASRILSKEKPDVIFSKGGFVTVPVVIAASMKKIPVV
SHESDLTPGLANKIASPFCDTLCVTFPESLKYIKDNKGELTGTPIREDLLKGDKERGRKF
CNFKENKKVLMIIGGSLGSKVINESVRKILNEILKEYNVIHLCGKGNLDESLKNLDGYRQ
YEYISGELPDLMALADLVISRAGANTIFELLALRKLNILIPLSANASRGDQVLNANSFEK
SGYSMVIKEEELNSELLLKSIKDLEKNREKYLNSMKMSKIGNGVNNIIDIIKKSAHM

Enzyme Prediction     

No EC number prediction in MGYG000002372_02428.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	190	336	1.2e-39	0.9235668789808917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	3.50e-152	5	351	3	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	2.48e-145	3	356	1	356	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	8.04e-124	5	351	1	347	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	2.27e-115	5	355	2	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	5.64e-93	5	351	2	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOY54830.1	8.99e-253	1	357	1	357
ATD47818.1	1.49e-251	1	357	1	357
SQI05353.1	1.49e-251	1	357	1	357
AQW24610.1	1.49e-251	1	357	1	357
AQW27643.1	1.49e-251	1	357	1	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	3.16e-34	2	317	8	326	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	2.21e-31	3	302	2	299	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	5.21e-28	5	312	8	310	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TNP7	2.98e-252	1	357	1	357	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=murG PE=3 SV=2
Q8XIQ1	2.98e-252	1	357	1	357	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=murG PE=3 SV=1
Q0SRB4	7.01e-251	1	357	1	357	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=murG PE=3 SV=1
A0Q182	3.08e-178	1	353	1	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium novyi (strain NT) OX=386415 GN=murG PE=3 SV=1
A6M1F0	6.01e-174	1	354	1	354	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) OX=290402 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002372_02428.