CAZyme Information: MGYG000002372_02579

Basic Information

• Species: Clostridium_P perfringens
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_P; Clostridium_P perfringens
• CAZyme ID: MGYG000002372_02579
• CAZy Family: GT28
• CAZyme Description: Processive diacylglycerol beta-glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000002372_1|CGC40	42367.52	9.1304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002372	3343822	Isolate	South Korea	Asia

• Gene Location: Start: 2830349; End: 2831476 Strand: +

Full Sequence      

MMKKVLILSTSTGYGHNQAANSLMELIKNDDTEILVHDFLKENRFFDRSIVNGYDLCASS
LGTLYGLLYKISNIKFINNLVSFLFLPVANKLAKFIDSFNPDLIITTHPLAVSILSYLKK
RQIIKVPVISVVTDFKCHYTYVSKIIDHYIVACDFTKENLASKGIPKEKISPFGIPVKQD
FYKEDYHNYVENIIQSPLNILLMGGGMGLDNISKVLKTLIKNENPLNLTIVCGNNAELKK
ELCKEYGNIKGNKKLNILGYTTEIPKIMKSSDLIITKPGGLTTTESLLSHLPMIIPFIIP
GQESENREFLSKSNCAITINHLEELNKVINDLNKDNNKLINMRKSILDVLSSYSPEGTIK
LCTKMLNDSYNKRRY

Enzyme Prediction     

No EC number prediction in MGYG000002372_02579.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	200	346	1.3e-26	0.9363057324840764

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17507	GT28_Beta-DGS-like	1.16e-82	5	350	1	346	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam06925	MGDG_synth	8.59e-52	16	177	1	169	Monogalactosyldiacylglycerol (MGDG) synthase. This family represents a conserved region of approximately 180 residues within plant and bacterial monogalactosyldiacylglycerol (MGDG) synthase (EC:2.4.1.46). In Arabidopsis, there are two types of MGDG synthase which differ in their N-terminal portion: type A and type B.
PRK13609	PRK13609	2.42e-48	3	346	5	349	diacylglycerol glucosyltransferase; Provisional
PRK13608	PRK13608	8.88e-41	3	367	6	367	diacylglycerol glucosyltransferase; Provisional
PLN02605	PLN02605	6.96e-37	5	347	1	360	monogalactosyldiacylglycerol synthase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOY54975.1	2.99e-269	2	375	1	374
SQI05526.1	3.10e-269	1	375	1	375
ALG49808.1	1.73e-268	2	375	1	374
AQW24748.1	5.78e-267	2	375	1	374
AXH53400.1	2.35e-266	2	375	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WYI_A	6.65e-22	3	331	6	348	Thecrystal structure of Arabidopsis thaliana galactolipid synthase, MGD1 (apo-form) [Arabidopsis thaliana],4X1T_A The crystal structure of Arabidopsis thaliana galactolipid synthase MGD1 in complex with UDP [Arabidopsis thaliana]
7D1I_A	2.29e-08	168	332	160	329	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54166	1.22e-40	3	356	5	359	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=ugtP PE=1 SV=1
A8FED1	2.53e-38	3	375	5	378	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus pumilus (strain SAFR-032) OX=315750 GN=ugtP PE=3 SV=1
Q65IA4	3.52e-38	3	356	5	359	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ugtP PE=3 SV=1
B7IW03	5.44e-37	4	375	6	375	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain G9842) OX=405531 GN=ugtP PE=3 SV=1
B7H9Q4	2.03e-35	4	375	6	375	Processive diacylglycerol beta-glucosyltransferase OS=Bacillus cereus (strain B4264) OX=405532 GN=ugtP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002372_02579.