CAZyme Information: MGYG000002373_01585

Basic Information

• Species: Clostridium septicum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium septicum
• CAZyme ID: MGYG000002373_01585
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1318	MGYG000002373_16|CGC1	147475.24	4.4507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002373	3298966	Isolate	France	Europe

• Gene Location: Start: 62719; End: 66675 Strand: +

Full Sequence      

MKKQSKKVLKNALATTCAVTIVTTMTGGNLIKAETITKDGERVQANIYPVPQNLEYSSDE
GMTLEGEVNVVIHGKQEEATLPKLEEILDENNINYSISDFVNNEKANIIISSEKDHCEDC
IKGEIEESNVLSKKEAYILKSSNDENKKGNISIIGSDADGVYYGVLTLAQILEQSTSEDK
FAEVIISDYPEIEFRGFIEGFYGTPWSHEDRMNLMKETSKFKMNTYIYAPKDDPYHRKQW
KELYPEDKATQIAELAKAGNDNNFNFCWTIHPGATLKFTDEDYNALIRKFEQLYDLGVRQ
FGVLFDDTDDWYNGRKQAEWINKIDTEFVKAKGDVAPMIVISARYNSAWGPNMNVYFKPF
METLHDDIQVMWTGHATMSNVSKEVFEWPKVQTGVNKDVAVWWNYPVNDYCDSRILMAPL
HNLSTDLDNVSGFFSNPMNQAEASKVALYSIADYTWNTDSFDYMKSWETSINRFVPEVTE
EFKRFASNTCYLKDDGGASGLFEYDESWYLSEKIDALKNAITNKENVKGEAEALLAEFKT
MNSDYEAITTKVKNENLLTELDPFLKSYKALSEAGIAAMNALISAQDGEVGTWLNENSVA
TEKLDLMDTFKVSRLEDEHGQVVTKEYVVSVGEKRLKPLVKEAIGASQSIISNSILVNNE
PKVISSIDSLLSKTVEVSGGNYAIKNIENVTLNKDDYVGIALPKAMKLGEVKVNASNYDN
LSIEYSINGIQWDKAETIIEGETLKTNASISATYVRVLNDSKEAININIENIQAIPVYKA
TPIISQNIGTYQNYVIENALDGDMDTKYWSDKASGNGHYIQLDLGNNIPLHDISAYFNGE
DYMRNSEFMISKDGSTWTSLGDLQYSDKEGKKVASADANGEMARYIKIQANGENNGCWVQ
LCEFQFNKTVPELGDDTVELVTGTPEGNWRNLYDGDLSTAFEAENVQDGDALVYKMSRVT
KVSELSFLQDANKICGAEVSIKDLNGKWIDIGSLDSQFNKLNVSKQILEVKLTFDPSKPA
PKIYEIMAKEGEVSEAEKFKRHLEIAVSEAKKIDENVLDKVVPAVKKEFNDALIEAEEVL
NDSTSTQKQIDDAFERLSEVMHMLSFEKGDKENLISLVNEINTLNSNEYIKETWDKLQIV
LGEANSVIADENAMKNEVAETYDKLLRAFLDLRLKPSKDKLQDLINEAEKKDRNEFVVES
FAVLEREIVNAKAIIEKEDATEEEIGNAEKALDLAMKGLVASAGNKDENNNNGNTNNGNN
ANGSNGSNSNVSTSGKNNGRKNELPKTGIEALGHLQTLGAMFSTLGTALLLKKKTKNK

Enzyme Prediction     

No EC number prediction in MGYG000002373_01585.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	195	486	4.7e-106	0.9932203389830508
CBM32	790	905	3.2e-17	0.8951612903225806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	5.12e-141	195	485	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam00754	F5_F8_type_C	1.57e-13	793	903	11	125	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam02838	Glyco_hydro_20b	1.64e-11	46	188	3	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
cd00057	FA58C	5.14e-05	801	897	30	135	Substituted updates: Jan 31, 2002
COG1196	Smc	5.57e-05	989	1196	807	1011	Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE33733.1	0.0	1	1318	1	1318
QAS61890.1	0.0	1	1318	1	1318
ATD57955.1	0.0	1	1318	1	1320
SLK13973.1	0.0	1	1318	1	1320
QBJ74644.1	0.0	1	1318	1	1320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PV5_A	3.32e-104	29	613	29	606	Structureof CpGH84B [Clostridium perfringens ATCC 13124]
2CBI_A	3.63e-101	38	605	4	565	Structureof the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBI_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase [Clostridium perfringens],2CBJ_A Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2CBJ_B Structure of the Clostridium perfringens NagJ family 84 glycoside hydrolase, a homologue of human O-GlcNAcase in complex with PUGNAc [Clostridium perfringens],2V5C_A Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2V5C_B Family 84 glycoside hydrolase from Clostridium perfringens, 2.1 Angstrom structure [Clostridium perfringens],2VUR_A Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2VUR_B Chemical dissection of the link between Streptozotocin, O-GlcNAc and pancreatic cell death [Clostridium perfringens],2X0Y_A Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens],2X0Y_B Screening-based discovery of drug-like O-GlcNAcase inhibitor scaffolds [Clostridium perfringens]
5OXD_A	1.63e-100	38	605	6	567	Complexof a C. perfringens O-GlcNAcase with a fragment hit [Clostridium perfringens]
2J62_A	1.82e-100	38	605	4	565	Structureof a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2J62_B Structure of a bacterial O-glcnacase in complex with glcnacstatin [Clostridium perfringens],2WB5_A GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens],2WB5_B GlcNAcstatins are nanomolar inhibitors of human O-GlcNAcase inducing cellular hyper-O-GlcNAcylation [Clostridium perfringens]
2XPK_A	6.57e-100	38	605	4	565	Cell-penetrant,nanomolar O-GlcNAcase inhibitors selective against lysosomal hexosaminidases [Clostridium perfringens],2XPK_B Cell-penetrant, nanomolar O-GlcNAcase inhibitors selective against lysosomal hexosaminidases [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TR53	1.99e-96	38	605	34	595	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	2.73e-96	38	605	34	595	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q89ZI2	1.43e-93	134	575	99	530	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
P26831	2.06e-70	47	1017	41	1067	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	4.85e-32	196	456	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001752	0.751933	0.245371	0.000413	0.000268	0.000244

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002373_01585.