CAZyme Information: MGYG000002374_00105

Basic Information

• Species: Campylobacter testudinum
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter; Campylobacter testudinum
• CAZyme ID: MGYG000002374_00105
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000002374_1|CGC1	39382.55	9.7424

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002374	1770849	Isolate	United States	North America

• Gene Location: Start: 112431; End: 113495 Strand: +

Full Sequence      

MKKLIIFFASVCLLFGASNNETELKTMIGQMVMVGFSHSSANDSWTDQLVLDASLGRIGG
VMLLARNISTKDELTKLTKKLSSSKAKQKLLIAIDEEGGKISRFINKDGFKHFPSAYEVG
SKMNLNEASTVYKDMADQLKSLGINMNFAPVVDVYNPNSSIIGQKDRAFSKNPDEVIAYS
SEFIKAFDKANVKTVLKHFPGHGNAIKDTHKEKTVVDNYDFDELKPYFELIKRDQANFIM
AAHVYIPKLDDKNPAVLSKHIVSDILKNRFKFKGAVMSDDLLMKGLGDLSIEQKVIKAIN
AGVDIILVSEYFLNNSNSIKIINDAILNAVNSGKISKDRIKDAYTRILRSKEGL

Enzyme Prediction     

No EC number prediction in MGYG000002374_00105.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	83	308	1.7e-50	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.20e-77	28	352	7	313	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK05337	PRK05337	5.11e-61	58	308	26	279	beta-hexosaminidase; Provisional
pfam00933	Glyco_hydro_3	8.38e-60	28	349	6	315	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	7.04e-07	113	351	120	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGZ81634.1	1.38e-234	1	354	1	354
ALV64793.1	3.96e-234	1	354	1	354
AJB45374.1	5.63e-234	1	354	1	354
AVK81040.1	1.61e-233	1	354	1	354
QCT99771.1	2.38e-219	1	354	1	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	7.50e-37	24	312	13	302	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
6JTI_A	3.68e-33	58	308	69	324	Crystalstructure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_B Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_C Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_D Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_E Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTI_F Crystal structure of native NagZ from Neisseria gonorrhoeae [Neisseria gonorrhoeae],6JTJ_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTJ_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-acetylglucosamine [Neisseria gonorrhoeae],6JTK_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_C Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_D Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_E Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTK_F Crystal structure of NagZ from Neisseria gonorrhoeae in complex with N-trifluoroacetyl-D-glucosamine [Neisseria gonorrhoeae],6JTL_A Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae],6JTL_B Crystal structure of NagZ from Neisseria gonorrhoeae in complex with zinc ion [Neisseria gonorrhoeae]
3BMX_A	5.17e-32	20	307	40	347	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GVF_A	1.57e-31	58	308	26	278	Crystalstructure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVF_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to GlcNAc [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVG_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4GVH_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) covalently bound to 5-fluoro-GlcNAc. [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_A Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],4HZM_B Crystal structure of Salmonella typhimurium family 3 glycoside hydrolase (NagZ) bound to N-[(3S,4R,5R,6R)-4,5-dihydroxy-6-(hydroxymethyl)piperidin-3-yl]butanamide [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3LK6_A	2.16e-31	20	307	14	321	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5QUZ5	3.76e-38	58	308	26	276	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1
P48823	8.06e-37	27	307	21	334	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q0AF74	8.18e-36	46	308	18	282	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1
C4LEY6	8.53e-36	58	307	26	275	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
Q8EEW2	1.41e-35	57	308	25	279	Beta-hexosaminidase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000830	0.274738	0.724138	0.000095	0.000112	0.000103

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002374_00105.