CAZyme Information: MGYG000002375_00631

Basic Information

• Species: Clostridium_G tetani
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_G; Clostridium_G tetani
• CAZyme ID: MGYG000002375_00631
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
314		36467.61	9.6533

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002375	2890495	Isolate	China	Asia

• Gene Location: Start: 26361; End: 27305 Strand: +

Full Sequence      

MRKIYKLFKLTILLFILLASFTFFKSINNKEFISNSSSKVYINSSDKISKDIGLQINWKE
VAALHGVYLKNNFSNASEEEVLNLAKKFVDKNTHSTKFKGSIYKLVPLEEVMNNLSFKEK
EKKKVYKNLDLLKDKYIVKVSEEKETFISALTPEAKSIYKEYDILPSIVIGQAILESDWG
KSKLSSNYNNLFGIKATTSWKGKTVKMETSENYDDTIIDVFRSYDSKGNSLKDYAKFLKD
NRRYKENGVFNSKTYIEQADSITKAGYSTKKDKDGNHMYGNLLTEIIREYNLQLIDNEVQ
NEYFKQIYSQQENF

Enzyme Prediction     

No EC number prediction in MGYG000002375_00631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	153	292	2.2e-35	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	7.00e-45	141	297	40	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK05684	flgJ	8.19e-24	147	288	155	295	flagellar assembly peptidoglycan hydrolase FlgJ.
PRK12709	flgJ	4.30e-23	141	269	170	304	flagellar rod assembly protein/muramidase FlgJ; Provisional
pfam01832	Glucosaminidase	1.23e-22	153	234	2	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	5.35e-22	145	294	9	143	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVP54965.1	7.32e-219	1	314	1	314
AAO35072.1	3.33e-215	1	314	1	314
QBD84176.1	1.85e-212	1	314	1	314
CDI48504.1	1.19e-208	1	314	1	314
ACA56431.1	3.01e-94	9	305	10	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	5.78e-17	145	296	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	6.08e-14	141	298	57	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	2.35e-11	143	289	2	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	3.12e-11	143	289	2	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	3.29e-11	145	285	2	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.31e-20	142	296	46	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	2.59e-16	145	269	161	290	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9KQ15	2.10e-13	142	269	159	291	Peptidoglycan hydrolase FlgJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=flgJ PE=3 SV=2
Q2G222	3.22e-13	141	298	317	474	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
Q9CIT4	2.66e-12	145	296	63	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.898371	0.090408	0.010027	0.000266	0.000151	0.000783

TMHMM  Annotations     

start	end
7	24