CAZyme Information: MGYG000002378_00584

Basic Information

• Species: Akkermansia sp001580195
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp001580195
• CAZyme ID: MGYG000002378_00584
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
956		109972.5	9.1423

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002378	3103583	Isolate	not provided	not provided

• Gene Location: Start: 142340; End: 145210 Strand: +

Full Sequence      

MKSFAIFKIIFCILSTVPLIKAEDKIPFPVIENGNGASIYYSGKNKVIQTAIDILIKDSQ
QVCRKKGISLTDSEKEGDILVGVIGEDKTFDTLCSQHYPKYKELKGKWETFLIHPIRSHD
NKKKLLIAGSDTRGAAYGILELSRSMGISPWIWWADVIPEKKDSVLWNRSPQHVQGPSVP
YRGIFLNDEDWGLMPWSTKNYDPTNRAGEIGIRTYSKIFELMMRLRANTLWPAMHECTVP
FHFVKDARETAEKYGIIIGTSHCEPMMRNSAGEWNDQLNGPYNFVTNSNNVIRYWKERLL
EVGQKENIYTIGMRGRHDGRMQGVNSLEEEKNVLQQVIRSQRELLTKHVNGNIKKIPQIF
VPYKEVLKVYNNGLSLPDDITLMWSDDNHGHLTRLNSDKEKSRTGGSGIYYHISYWGAPQ
DYLWLASTQPGLIYQEMQRAWENQARKIWILNVGDIKPAEYLMEFFLDMAWNIHSMDSNT
IRSHLSSWVSRQFPGYEHEISPLLNLYYDLAAQRKPEHMEFLPSKKGILFSNPYNFHEFG
DEAGRRIYGYQVISDLSEEIYKKMDHERKDSYFQLVHYPVSAAASMNKKVLYAQKARELA
VYNLPAANNYSTLSKKEYDKISQLTHHYNVEISNGKWNGMMSMSPRNQSVFKCPEFPEFI
TSTKKGLLLWVDGNPSPSEERQVTLPTLTKGGKRPSTVTVYQRDNDNIVYEAVDIPKGFQ
IQTNPLPGGEVQIAVYADSTTQDGRNTIKIKLNGEYYEFICPAVSAKTNMPQQFIENQFY
ISFPAAQQINNHLKTKVIDSLGHSGSSIVLPKSSEDHKNKHAFYEFYSVSKGQFNLYIGS
IPIHPQYEKKLRYAVIIDNQAPVIVSTYAEFHTKKWNLNVLRNQSLTSSQHIIEKPGKHA
IRIYALDEDLYLDQIMIDFKKNRKFYAIPCSYCNNPFYSIINKNPVIKNKGLPTKK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	28	915	2.2e-218	0.994261119081779

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	6.53e-169	177	518	3	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.08e-19	774	919	2	160	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.002	37	142	22	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE97664.1	0.0	384	956	6	578
AYR35381.1	0.0	384	956	6	578
QTF02289.1	0.0	384	956	6	578
QHV49212.1	0.0	384	956	6	578
QTF04600.1	0.0	384	956	6	578

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	9.45e-178	30	928	21	783	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4ZMH_A	3.60e-118	46	929	33	930	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	3.42e-102	79	929	65	960	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4C90_A	1.70e-95	28	641	44	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	6.38e-95	28	642	16	625	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000204	0.999192	0.000157	0.000144	0.000143	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002378_00584.