CAZyme Information: MGYG000002378_00717

Basic Information

• Species: Akkermansia sp001580195
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp001580195
• CAZyme ID: MGYG000002378_00717
• CAZy Family: CBM51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637		69294.79	7.2779

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002378	3103583	Isolate	not provided	not provided

• Gene Location: Start: 292456; End: 294369 Strand: -

Full Sequence      

MDFMSKRFFVLLLALGMGNWNALGMDGDASTAAPVQPAAPAAGAEFTRLPVSWKANPRDV
ATAKAAWKTLNAYHQGKPVSGRKLHVVYVTFKDRPALDKYRERYDHLLKNIQAYYADQMQ
ANGFPPLTFKLDLDDRGRLIVHDAYVDKPMSGMNVQNSGPVSREAARKVLASKGIDIEKE
HVLIICQLPDGVGPYYGGGFSHQGTGWTCDQEGLDPANFLDTSMMEGGRFKVTKGRNASI
YIGGTAHELGHSFGLPHTGTGWDYPDAGESLMGSGNYTYGNELRKEGKGSFLSPTDALKL
ASVPLFNGVETSLPPDASFGRMIGKYVPGSFERLEAVPVKDGLRLKGKARLDRPAYGVVV
HLDPPGGSDYDSNAVGAALNDEGEFDLTICRPGFKGGFIEMRVAVLNCDSTRCMTTLPVW
LDGKGARVPSLAQSVYFGDVQNLWIRGRMDEARKALAEVERRHGARPEVQEWLPVWKRAL
ERRDASQEFTPAGVPADLASISLNDCKPSVAQVGWAVPLWDVLFPSDLGPVPFFKTIGRP
ERFILAHAPAVFAYDLNGAWKEFRADVGLPFGSRGSVRFGVYLDGKKLFESPVLKDGSSV
PVQVAVEGGKKLEIRVDDAGDGNTADWGIIANGVLAR

Enzyme Prediction     

No EC number prediction in MGYG000002378_00717.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM51	544	632	9.1e-21	0.6791044776119403

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08305	NPCBM	4.52e-29	500	635	2	135	NPCBM/NEW2 domain. This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins. This domain has also been called the NEW2 domain (Naumoff DG. Phylogenetic analysis of alpha-galactosidases of the GH27 family. Molecular Biology (Engl Transl). (2004)38:388-399.)
smart00776	NPCBM	1.73e-21	500	632	4	141	This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins.
pfam12044	Metallopep	1.75e-07	112	338	138	412	Putative peptidase family. This family of proteins is functionally uncharacterized. However, it does contain an HEXXH motif characteristic of metallopeptidases. This protein is found mainly in fungi. Proteins in this family are typically between 625 to 773 amino acids in length.
TIGR03296	M6dom_TIGR03296	0.003	242	278	166	206	M6 family metalloprotease domain. This model describes a metalloproteinase domain, with a characteristic HExxH motif. Examples of this domain are found in proteins in the family of immune inhibitor A, which cleaves antibacterial peptides, and in other, only distantly related proteases. This model is built to be broader and more inclusive than pfam05547.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO90903.1	0.0	4	637	1	634
QWO93739.1	0.0	4	637	1	634
QWO96312.1	0.0	4	637	1	634
QWO86470.1	0.0	4	637	1	634
QWP71076.1	0.0	4	637	1	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z2D_A	3.26e-17	80	396	17	321	ChainA, O-glycan protease [Akkermansia muciniphila ATCC BAA-835]
6Z2O_A	3.30e-17	80	396	18	322	ChainA, O-glycan protease [Akkermansia muciniphila ATCC BAA-835],6Z2Q_A Chain A, O-glycan protease [Akkermansia muciniphila ATCC BAA-835]
6Z2P_A	3.48e-15	80	396	18	322	ChainA, O-glycan protease [Akkermansia muciniphila ATCC BAA-835]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000823	0.998072	0.000413	0.000290	0.000202	0.000166

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002378_00717.