CAZyme Information: MGYG000002378_01638

Basic Information

• Species: Akkermansia sp001580195
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp001580195
• CAZyme ID: MGYG000002378_01638
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1046	MGYG000002378_37|CGC2	111037.79	4.76

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002378	3103583	Isolate	not provided	not provided

• Gene Location: Start: 132128; End: 135268 Strand: -

Full Sequence      

MMNTFQTLRRTFISAAVLFFLCLGTGMTRGADEAVSENFDSFPTGGFTTLATALGTMTAE
SGHAAIADNRYSSLPNCMRLIGQGAGTKSTATLTLPSPLAARKILSLTGERWTRDSPFSF
TIHAADQEGNETLAVDGSSLQTGNSPMTQQVQGVLPSGTVRLIFRCEAPANTGVLFDDLV
LSPFQPFSSAAEAWPAMIRMEANGILRFSLTNVPASYAGMAVTVDMSPSDDLADIESVSL
YTGDANSIYSAPAYGASGHGAMSSRGVLASPAQPPAAVMTFPVTPGALVDGQQYYFWVSV
KLKDSASMDHKVGARIASITVDGQTDDFADGVTARQRIGYAIAKANDPVYGGPTEGKTSR
KFRIPGIVRAKNGDLVSVFDIRYDGRNDMQANIDTGCSRSTDNGRTWTPVHVAVNFNPTG
EAANDYNAGYGVSDPCILVDEVNGTLWLAGIARHGLASSKANVDVESLETVQYVVACSTD
NGQTWGSIDPDTGKFVKTKPRSINKDIKNKAWKSFFQGPGHGITMKKTVNGVRPIVFPSQ
IWTGSSGTGTPQSCIIYSLDRGQTWISEDTGKSGTLGIGASSSECVVTELSDGRLMLNAR
NENKSGYRKIFTTDDMGKTWTPHATNLNSLPEPAACQASQLAVENSGNISRALLFSNPSK
TAAPRALMTLKASFDEGSTWPSGSQVLYDSRPSSGYSDICETGDGHIGVLYEGLNGDENI
FFLRIPYEEFLPSLDVPATGQIIRVGAEGTTAATFTVSSDASWTATSSAGWITVSPSSDS
GNGTVTYSVDRWEGAGERTGTITISVPGIQPAVITIIQSGREPSLTFSPPILILPKNGGT
AVFSVTCDAAWNVSKTAAWLDITGTQDTETGNGTVSVTAAANAAAGSRTAELSFSSFGTV
RSATVVQRGQKRTWDEWKEDEIASRDPDTDQTGPTDSPAGDGIPNLLKYATGLDPLKPCG
SVVQVSTEKTNGGTFLVLAWPVNPEATGIRHLVESSEDLQTWTEMAEVETEGKSSAIFRD
TVPINAESPPRRFLRLKISREEENPH

Enzyme Prediction     

No EC number prediction in MGYG000002378_01638.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	355	726	8.9e-79	0.9590643274853801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	4.54e-79	362	726	14	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd14948	BACON	8.92e-18	743	819	9	83	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13859	BNR_3	1.91e-16	364	621	1	212	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	1.95e-16	398	709	23	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam14873	BNR_assoc_N	3.96e-15	191	325	8	149	N-terminal domain of BNR-repeat neuraminidase. This domain is usually found at the N-terminus of the BNR-repeat neuraminidase protein family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP54611.1	0.0	2	1045	1	1044
QWP27708.1	0.0	2	1045	1	1044
QWP61791.1	0.0	2	1045	1	1044
QWP69127.1	0.0	2	1045	1	1044
QWP03917.1	0.0	2	1045	1	1044

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MYV_A	1.16e-68	295	712	121	504	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	2.19e-68	295	712	142	525	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]
6MNJ_A	1.32e-67	288	712	135	521	Hadzamicrobial sialidase Hz136 [Alistipes],6MNJ_B Hadza microbial sialidase Hz136 [Alistipes]
4FJ6_A	3.41e-64	295	712	122	504	Crystalstructure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_B Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_C Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503],4FJ6_D Crystal structure of a glycoside hydrolase family 33, candidate sialidase (BDI_2946) from Parabacteroides distasonis ATCC 8503 at 1.90 A resolution [Parabacteroides distasonis ATCC 8503]
4Q6K_A	3.36e-61	295	712	124	507	Crystalstructure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_B Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_C Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185],4Q6K_D Crystal structure of a putative neuraminidase (BACCAC_01090) from Bacteroides caccae ATCC 43185 at 1.90 A resolution (PSI Community Target) [Bacteroides caccae ATCC 43185]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31206	2.03e-65	195	712	34	526	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
Q02834	3.87e-30	331	712	31	386	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P15698	6.08e-21	362	717	54	384	Sialidase OS=Paeniclostridium sordellii OX=1505 PE=1 SV=1
P10481	1.70e-17	359	732	33	374	Sialidase OS=Clostridium perfringens OX=1502 GN=nanH PE=1 SV=1
Q5RAF4	4.06e-13	362	729	77	395	Sialidase-1 OS=Pongo abelii OX=9601 GN=NEU1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000575	0.998068	0.000731	0.000218	0.000188	0.000170

TMHMM  Annotations     

start	end
12	31