CAZyme Information: MGYG000002378_02127

Basic Information

• Species: Akkermansia sp001580195
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp001580195
• CAZyme ID: MGYG000002378_02127
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480		52720.12	7.9107

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002378	3103583	Isolate	not provided	not provided

• Gene Location: Start: 156888; End: 158330 Strand: +

Full Sequence      

MNSILKPALCALALGVCGASPLLAAAATASCEQTHSVLYAGGVSQAIMKIKVTVTETSQI
LKGMTFSMAGTTSVADIAKAQIFASGTTPYFSPNSGQANRRAFPILNTISKGAKNLQFEG
SHPLSPGDNYFWLCVDLIPRARGLNKVDAACTGIALLEDSNIAISNPSPEGCAQVYPYQF
RVVPYYRHTNLMQWNRDQLNAQHFKSFTDLIYFNVGCDTDGNLTGQNNEQFLNGLDKLKN
LRGNAGSKIILGVAHCDAGMTAITADPEKRVKFARQLVSFAKEKGFDGIDIDWEYPDNDT
QWYHFSLFLGEVRSAMGANGMSLSSAINPYYLAPTSEMMDLLDFVNVMSYDRGGQHSTYP
DMVTDVNTMRNKNVPDCKIVMGLPFYTNETRSNRNWDAQKGYSTVIQLYPNMAPGTDTCT
IDGQQHYFNGITTIKKKCQYVKTQKLGGVMIWCYDGDLLLTHAKSLAKAMFGVIKQQAVR

Enzyme Prediction     

No EC number prediction in MGYG000002378_02127.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	181	463	5.5e-42	0.9527027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	4.94e-42	181	457	1	307	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	2.95e-37	221	457	61	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	4.63e-34	207	457	26	334	Glyco_18 domain.
cd00598	GH18_chitinase-like	4.51e-31	182	457	1	210	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
cd06545	GH18_3CO4_chitinase	4.96e-30	218	470	34	253	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP70637.1	0.0	1	480	1	480
QWO91390.1	0.0	1	480	1	480
QWO85994.1	0.0	1	480	1	480
QWO95829.1	0.0	1	480	1	480
QWO93300.1	0.0	1	480	1	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CO4_A	4.28e-20	248	452	67	279	Crystalstructure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],3FND_A Crystal structure of a chitinase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron]
5Y29_A	6.05e-18	266	457	100	351	Crystalstructure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	6.70e-18	266	457	100	351	Crystalstructure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]
6XYZ_A	1.56e-17	197	452	29	285	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
6BT9_A	2.21e-15	263	457	176	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G5EAZ3	5.66e-15	267	457	111	347	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
Q92222	5.66e-15	267	457	111	347	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3
Q9W5U2	1.07e-14	263	457	1999	2253	Probable chitinase 10 OS=Drosophila melanogaster OX=7227 GN=Cht10 PE=2 SV=2
P32470	8.75e-14	244	452	119	378	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
O14456	8.75e-14	238	457	116	383	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000300	0.998655	0.000502	0.000179	0.000164	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002378_02127.