CAZyme Information: MGYG000002378_02232

Basic Information

• Species: Akkermansia sp001580195
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp001580195
• CAZyme ID: MGYG000002378_02232
• CAZy Family: GT11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566		65798.11	6.8655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002378	3103583	Isolate	not provided	not provided

• Gene Location: Start: 273643; End: 275343 Strand: -

Full Sequence      

MVTAHWCTPAIMNALYTFSHRVPSVVCDVEHLHWKGEMLFYSNGVFRRRDTSCYGWWSIG
QKEELTLKWQMWPMEQLLLEEGVYVGSEMEIHQRRGMPSLYRLWSESKLSARSAEIMDQS
PLLYIHLGCGNRRLNGWLNLDAPNYDITRPLPWKDDSVDAFYLEQVIDKVTPIEACRFFA
EAFRCLKPGGFLRLSFRDIRLMHGVVTPAFRQYMKKRLREKPASEHDLCTLMEAYQHQSL
WNTDFLSYLLEEFGFRVSQHTPGASRHLHLQCLERRIDRDEHPFDLLGVVCLDAGKSKKR
RPRGFLSLPSDSDQISPEYVTLQFMPGARTGNYLFQIAATYAHALRTDVGCRIPWRHDLN
TWKLMSYLGGACSPCPDGGYSDPVTYRESRFSYRSIPDTVRRGALSGYFQSERYFKDFAE
EIRSLFQPLIAPVRESTAGVHLRMGDYLQRTDMYHTPDAAFLNEAFKNLSDNIKTLVVFS
DSPDLARKLVEGVPEARRFEIVMDEHETLDALRELTAMQELVLSCSSFSWWGAWLGSQQR
VFIQKQWFTGNIEDEQDIFCPTWIKL

Enzyme Prediction     

No EC number prediction in MGYG000002378_02232.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	404	566	1.1e-33	0.6376811594202898

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.21e-19	319	547	1	252	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	2.06e-10	405	564	126	295	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
COG4627	COG4627	2.27e-08	125	278	7	173	Predicted SAM-depedendent methyltransferase [General function prediction only].
pfam08241	Methyltransf_11	1.29e-05	146	192	49	92	Methyltransferase domain. Members of this family are SAM dependent methyltransferases.
pfam13649	Methyltransf_25	2.47e-04	146	190	54	97	Methyltransferase domain. This family appears to be a methyltransferase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO91288.1	0.0	1	566	186	751
QWP70739.1	0.0	1	566	186	751
QWO93402.1	0.0	1	566	186	751
QWO95931.1	0.0	1	566	186	751
QWO86096.1	0.0	1	566	186	751

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002378_02232.