CAZyme Information: MGYG000002378_02343

Basic Information

• Species: Akkermansia sp001580195
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp001580195
• CAZyme ID: MGYG000002378_02343
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850	MGYG000002378_46|CGC2	96954.17	7.7826

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002378	3103583	Isolate	not provided	not provided

• Gene Location: Start: 137580; End: 140132 Strand: +

Full Sequence      

MTTFPLRTLFGTLLALYCMHAGYSLSPEERDAARSVMERTVPVLKAGPGKLKLEAVKQEN
GCDVFETESSGGVLTVRGSSGTALCRGFYDFLKTNGLGMVAWDNKDIRWPARISDTPRRR
VASPFRHHYYFNAVTYGYTMPYWTWERWEREIDWMALHGIDMPLALAATEGIAVRVWKRL
GLTQKEIDEFYTGPAHLPWQRMGNLVNHDGILNDNWHRDQIAMQHNILHRMKSLGMKPVC
PAFSGFVPQGIRRLYPEAKLHRLGWGGWPQKNAAHFLSPEDPLFLHIGSLYMEEWQKEFG
KNTYYLADSFNEMELPVNTEDPKTRDQMLSALGEQVYRSISSVNPDAVWVMQGWMFGYQR
HIWNADSLKALLSKVPDDQMLLLDLAADYNKTFWHNGMNWDVFKGFFNKPWVYSVIPNMG
GKCAMTGVIDFYANGHLEALESASKGKLAGMGMAPEGIENNDVLYELVTDAAWRDRRENV
EQWLEKYCRARYGACPDSLKTAWNLFRSTAYSNLKDHPRFNWQLKPGSRSSSVDTSEDFL
RGLALFVNTEGLEHSPLFRQDAVEMAVHYLGIRMHEAIQAALEALDEQNPEHAVKCMAHF
REYALQADALLESHPTWRLSRWISFARAHGKTGEKKDAYEENARRLATIWGPPVNDYAAR
LWSGLIRDYYLPRWEHFFQNRLKDKAPDMEAWEEAWVHSHGVSPARRPGDIIRACRQYVR
EAKPLPPSLKGGGSGSAIGNWTPAEVSTEWKWVAWPVSPDDLKNLRGVRFTYTSGRHALE
IEQVELVGDGRMIDGRRHAGLAGKPSRENCYQLSLPEGVHANNGLLIRAKVRTVGGNDSR
GKIELLKKND

Enzyme Prediction     

No EC number prediction in MGYG000002378_02343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	72	719	4.7e-206	0.9924585218702866

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	1.92e-166	129	475	2	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	8.72e-50	483	716	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	5.01e-16	31	112	1	79	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWO92760.1	0.0	1	849	1	849
QWP70100.1	0.0	1	849	1	849
QWO85452.1	0.0	1	849	1	849
QWO95290.1	0.0	1	849	1	849
QWO91935.1	0.0	1	849	1	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	1.84e-121	28	724	2	713	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	3.44e-76	50	698	189	848	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	3.86e-76	50	698	197	856	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	3.18e-75	50	698	212	871	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	3.44e-121	21	724	18	736	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	9.41e-120	26	724	42	806	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.169722	0.827434	0.001864	0.000334	0.000278	0.000356

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002378_02343.