CAZyme Information: MGYG000002378_02433

Basic Information

• Species: Akkermansia sp001580195
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Verrucomicrobiales; Akkermansiaceae; Akkermansia; Akkermansia sp001580195
• CAZyme ID: MGYG000002378_02433
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852	MGYG000002378_47|CGC2	94350.71	9.0938

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002378	3103583	Isolate	not provided	not provided

• Gene Location: Start: 32726; End: 35284 Strand: -

Full Sequence      

MISRYASVCSVLGLAAAPVVLAAPADVSPVAAVEGVVERVTPSAKGAVSFKLNPALQNRI
TISGAPGSIRVEASDVRRLIAGYGWYLKNIAKVHLSWNGNRLAPPSPLPAPASPVTIESP
WKTVFAYNYCTLSYTAAFWDWKRWQQEIDFLALNGFTHALVTAGLEKTWEDFLIGLGYPR
DKAIRFIPNPAFAAWWNMGNLEGHGGPLTQRQIDEMAQLGKRIVSRMEQLGMTPVLQGYV
GFVPADFSENVRMKGLKLIPQGEWVNFKRPWMVDPTCEAFPKLAADWYRSLRKVYGISGK
MFGGDLFHEGGSKGNINVTQAAEAVQKAMQKASPGSTWVIQAWGGNPSRELLNGMDPKHA
LVLQLTKDMADGGKNLRTFDGIPWVWCELSNFGGNTGMYGGIPLLSRLGSDLSAYMDKGL
TGMGVLSEGLETNPLHYALFCDRLWTLEDIPVKEWLRQYALQRYGKAPESVVHALGVLSS
SIYSPVRSQEGCTESIVCARPAWNVRKASTWSSGERYYRLGDIVSAARDYLKAANEQPSL
MKEETFRYDLVDLVRQVLADAAFYQLQRVRAAFDARDVSGYKKQVQVFLSLITDMDAVLA
TDRQFLLGTWQEKALNWGKTSQEKALMDRSAKMLLTTWIDQAPRALNDYSNRQWAGLVAD
FYLPRWKNFFESQLEVLTGKKDRAAADASFLDKTVREELSFAGNGKVYPVVPSGDVLAVA
NRVMKARRKVLDSLCRDEKHSSGLAWDLKQGSPLRFDVTDRVDAPGTYTATFQWKGGSSA
LKIHSVKLYEGDREVAADVHEGWTGVENNGNSYTLVLKKYRTNLDSYTLKAEVSGASGAD
SQGEMILKKNGN

Enzyme Prediction     

No EC number prediction in MGYG000002378_02433.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	67	725	1.8e-207	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	1.91e-128	125	446	2	332	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	2.30e-81	455	721	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	7.12e-15	31	101	1	73	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWP71243.1	0.0	1	852	1	852
QWO86637.1	0.0	1	852	1	852
QWO93908.1	0.0	1	852	1	852
QWO96475.1	0.0	1	852	1	852
QWO90734.1	0.0	1	852	1	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	1.02e-108	67	679	212	830	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.22e-108	67	679	220	838	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.22e-107	67	679	235	853	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	6.15e-90	31	723	7	707	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	5.59e-89	31	723	30	730	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	2.02e-86	69	724	95	801	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000357	0.998872	0.000211	0.000200	0.000186	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002378_02433.